Lus10011681 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10011681 pacid=23156327 polypeptide=Lus10011681 locus=Lus10011681.g ID=Lus10011681.BGIv1.0 annot-version=v1.0
ATGGATCTACAGACTCTGGAATGGATGTGTTTGATGCTCGAGTCAGTCTTGAATCAAGGAGCTTCAGTCACAAATGAAACAGAGTTTGGAGGATACAACT
TTCAACCACAAGTTGCCATGAATCGGCTCACTAGCACCTTCTCTGATTTTCCAGACTTGGACTTGGCTGTGAGGATCGATGGGGTGCTGGCAACAGTGAC
GGGGGTGCTCCGTGCACAACAGGTTTTCGTCGTGTTGGATATCTGTTTGGTAATGCCACAGGAGGGGGTATTGGACTCTTCTGATGATGATTCTGATTCT
GATCTTTCTGATGAAGATTATGGTGTTGAGATAATACCAGCTTAA
AA sequence
>Lus10011681 pacid=23156327 polypeptide=Lus10011681 locus=Lus10011681.g ID=Lus10011681.BGIv1.0 annot-version=v1.0
MDLQTLEWMCLMLESVLNQGASVTNETEFGGYNFQPQVAMNRLTSTFSDFPDLDLAVRIDGVLATVTGVLRAQQVFVVLDICLVMPQEGVLDSSDDDSDS
DLSDEDYGVEIIPA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10011681 0 1
AT5G39650 DAU2 DUO1-activated unknown 2, Prot... Lus10012821 2.2 0.9685
AT5G51890 Peroxidase superfamily protein... Lus10038054 6.3 0.9518
AT1G14040 EXS (ERD1/XPR1/SYG1) family pr... Lus10030439 10.6 0.9585
AT1G35210 unknown protein Lus10036476 14.8 0.9656
AT4G36220 CYP84A1, FAH1, ... ferulic acid 5-hydroxylase 1 (... Lus10041511 15.2 0.9590
AT4G39720 VQ motif-containing protein (.... Lus10016814 15.5 0.9305
AT4G36220 CYP84A1, FAH1, ... ferulic acid 5-hydroxylase 1 (... Lus10022303 20.1 0.9550
AT4G36220 CYP84A1, FAH1, ... ferulic acid 5-hydroxylase 1 (... Lus10012583 20.6 0.9533
AT4G36220 CYP84A1, FAH1, ... ferulic acid 5-hydroxylase 1 (... Lus10034300 22.0 0.9410
AT4G08250 GRAS GRAS family transcription fact... Lus10008316 27.8 0.9525

Lus10011681 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.