Lus10011703 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G22870 422 / 4e-150 EMB2001 embryo defective 2001, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT5G11480 276 / 3e-92 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT5G58370 107 / 3e-26 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
AT3G12080 47 / 1e-05 EMB2738 embryo defective 2738, GTP-binding family protein (.1.2)
AT1G08410 44 / 0.0001 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT2G27200 44 / 0.0001 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039653 544 / 0 AT2G22870 426 / 2e-151 embryo defective 2001, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Lus10022126 284 / 3e-95 AT5G11480 418 / 8e-148 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Lus10011673 283 / 5e-95 AT5G11480 418 / 1e-147 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Lus10009919 103 / 7e-25 AT5G58370 473 / 9e-165 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
Lus10028574 44 / 0.0001 AT3G07050 743 / 0.0 nucleostemin-like 1, GTP-binding family protein (.1)
Lus10014289 44 / 0.0001 AT5G66470 587 / 0.0 RNA binding;GTP binding (.1)
Lus10018881 44 / 0.0001 AT3G07050 706 / 0.0 nucleostemin-like 1, GTP-binding family protein (.1)
Lus10004103 43 / 0.0002 AT1G08410 756 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Lus10023835 43 / 0.0003 AT1G52980 708 / 0.0 nuclear/nucleolar GTPase 2, GTP-binding family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G006300 432 / 9e-154 AT2G22870 434 / 2e-154 embryo defective 2001, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.006G243200 302 / 2e-102 AT5G11480 422 / 2e-149 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.018G037000 291 / 4e-98 AT5G11480 421 / 7e-149 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.014G006501 202 / 5e-66 AT2G22870 199 / 2e-65 embryo defective 2001, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.014G007450 132 / 3e-39 AT2G22870 131 / 3e-39 embryo defective 2001, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.019G128000 97 / 3e-22 AT5G58370 461 / 1e-158 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
Potri.009G017000 42 / 0.0004 AT1G08410 755 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.007G021900 41 / 0.0008 AT5G66470 535 / 0.0 RNA binding;GTP binding (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0023 P-loop_NTPase PF01926 MMR_HSR1 50S ribosome-binding GTPase
Representative CDS sequence
>Lus10011703 pacid=23145630 polypeptide=Lus10011703 locus=Lus10011703.g ID=Lus10011703.BGIv1.0 annot-version=v1.0
ATGCTTCTCCGGTACTGCCGTGTGCCAACCTTCCCACTCATTACGCCTCCGGCGAATCGGAAGTTTCTCCCTCTGAGCACCCATTTCATATTCTCCATTG
GAAGATCTGCTTCCTCTATCTCGCCGAGTCATGTGTCGGCTTCAAAGGCGGCAAAGCCGTTGGTGTCGGACCCAGCGAGGTCTGTTCGGACAGTTCTCTT
CGTTCCTCCGGGGATTGAGCTAGAGGAGGTGAGGGAGGACATGATTTTATCCGGTTCGAACATCGTAGTCGGACCATACGGGGGTCATTCGCAGATAAAG
GAAGTGGAGTTCGTGAAGAGCAGTGCGCGGGCAAAGGATTGCCCCAAAGATGATAAACCTGAGTTCGCCATTCTAGGGAGGTCTAATGTTGGAAAGTCTT
CGCTAATCAATTCTTTGGTTCGGAAGAAAGAAATTGCTCTTACATCTAAAAAGCCAGGGAAGACTCAGTTGATCAATCATTTCTTGGTTAACAAAAGCTG
GTACCTTGTTGATTTGCCTGGTTACGGGTTCGCCAAAGCATCAGATGCAGCTAGAATGGATTGGTCTGGATTCACAAAAGGATACTTTCTGAACAGAGAG
AGTCTGGTTGGTGTGCTTCTCCTGATTGATGCAAGCGTTCCTCCTCAAAAGATAGACCTGGACTGCGCAAATTGGCTTGGACGAAACAAAATACCATTAA
CTTTTGTATTCACCAAGTGTGATAAGGTGAAAGGTGGGAAAGGAATGCGGCCGGAAGAGAACATCAGTAATTTCCAGGAGTTGATAGATGAGAGTTTCCG
ACAGCAACAGCCACCTTGGATTATGACTAGTAGTGTCACCGGGCTAGGAAGAGATGAGCTTCTCTTGCATATGTCACAACTCAGAAACTACTGGGATCAG
TAA
AA sequence
>Lus10011703 pacid=23145630 polypeptide=Lus10011703 locus=Lus10011703.g ID=Lus10011703.BGIv1.0 annot-version=v1.0
MLLRYCRVPTFPLITPPANRKFLPLSTHFIFSIGRSASSISPSHVSASKAAKPLVSDPARSVRTVLFVPPGIELEEVREDMILSGSNIVVGPYGGHSQIK
EVEFVKSSARAKDCPKDDKPEFAILGRSNVGKSSLINSLVRKKEIALTSKKPGKTQLINHFLVNKSWYLVDLPGYGFAKASDAARMDWSGFTKGYFLNRE
SLVGVLLLIDASVPPQKIDLDCANWLGRNKIPLTFVFTKCDKVKGGKGMRPEENISNFQELIDESFRQQQPPWIMTSSVTGLGRDELLLHMSQLRNYWDQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G22870 EMB2001 embryo defective 2001, P-loop ... Lus10011703 0 1
AT1G02160 Cox19 family protein (CHCH mot... Lus10032273 1.0 0.8210
AT1G62930 RPF3 RNA processing factor 3, Tetra... Lus10021074 6.5 0.6943
AT4G39470 Tetratricopeptide repeat (TPR)... Lus10035707 6.9 0.7207
AT5G17660 tRNA (guanine-N-7) methyltrans... Lus10015923 11.0 0.7037
AT2G22870 EMB2001 embryo defective 2001, P-loop ... Lus10039653 18.9 0.7879
Lus10042733 21.7 0.6662
AT2G35450 catalytics;hydrolases (.1) Lus10037047 22.9 0.7841
AT2G30695 unknown protein Lus10004791 34.7 0.6980
AT4G04900 RIC10 ROP-interactive CRIB motif-con... Lus10007648 40.6 0.7289
AT1G62350 Pentatricopeptide repeat (PPR)... Lus10036049 47.1 0.6569

Lus10011703 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.