Lus10011712 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10011712 pacid=23145627 polypeptide=Lus10011712 locus=Lus10011712.g ID=Lus10011712.BGIv1.0 annot-version=v1.0
ATGGCCTCCTCCACCGACAGCCTCCTCCACCGATTGCATGCTCCACCGACAGCCTCCTCCATCTCCTCCACCGACAACCTCCTTCATTTTTCGACCTCCT
CACTGATGACCTCCTTCATTTTTCGGCCTCCTCCACCGACGGCTTCCTCCACCGACAATCTCCTTCAAGTTTCGGCCCCTTCCACCGACAGCCTCCGCTC
CACCTCCTCCATTGACGACCTCCTCCACCTCCTCCATCGACGCAGAGACATTGTCGCTGTTTGGAGTTTCAATCCTACCAGCGATTTAGTGGCTGCTGTT
AGGCCATTCAGTTTAACCATGGCCACTTGGGCCGCTGTTAGGCATTCTTTACGTTGGGACGCCTAA
AA sequence
>Lus10011712 pacid=23145627 polypeptide=Lus10011712 locus=Lus10011712.g ID=Lus10011712.BGIv1.0 annot-version=v1.0
MASSTDSLLHRLHAPPTASSISSTDNLLHFSTSSLMTSFIFRPPPPTASSTDNLLQVSAPSTDSLRSTSSIDDLLHLLHRRRDIVAVWSFNPTSDLVAAV
RPFSLTMATWAAVRHSLRWDA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10011712 0 1
AT1G17020 ATSRG1, SRG1 senescence-related gene 1 (.1) Lus10004582 1.4 0.7631
AT2G40220 AP2_ERF ATABI4, GIN6, S... SUCROSE UNCOUPLED 6, SUGAR-INS... Lus10040944 3.9 0.7606
Lus10021617 7.4 0.6592
Lus10017936 9.2 0.7531
AT2G36690 2-oxoglutarate (2OG) and Fe(II... Lus10001460 15.3 0.7212
AT4G39120 HISN7, IMPL2 HISTIDINE BIOSYNTHESIS 7, myo-... Lus10041968 38.8 0.7146
AT1G07710 Ankyrin repeat family protein ... Lus10015224 72.0 0.6525
AT3G43660 Vacuolar iron transporter (VIT... Lus10029776 78.8 0.6270
AT1G07420 SMO2-1, ATSMO1,... Arabidopsis thaliana sterol 4-... Lus10004988 80.4 0.6278
AT4G22410 Ubiquitin C-terminal hydrolase... Lus10035548 96.2 0.6158

Lus10011712 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.