Lus10011724 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G007000 84 / 7e-21 ND /
Potri.014G013000 40 / 0.0002 ND /
PFAM info
Representative CDS sequence
>Lus10011724 pacid=23145617 polypeptide=Lus10011724 locus=Lus10011724.g ID=Lus10011724.BGIv1.0 annot-version=v1.0
ATGGGAAACCACAGAAAGAGCTGTTCACAAGGGAGCATCCCCTTCTCATGGGAGGATTCCCCTGGAGTTTCCAAATCCATCCACCCCACCCCACCGCCTC
TATCTCCGCGCCGCCGGTCCATATCAGTCCCCACATTCACTGTCGATGATTCAGCCCGCAACAAGGAGAAGAAGATGAAGATGAATAGTGACAATCATAA
TCGCAGCCTTCCTCCGCCTCCTCCTTCAAGCAGTACCAAATTGCAAAGGGGAAGCTTGTCTGGTAAAACGGCGACGTTTGGGAGGTGTGGAGTTGAGGAC
CCTTTCCTAGCTGCCTACAAAGAGTGTACCAAAGATCGATTTCGGTGGTGGAAGCTTACTAATCCGAACAAAACCATCTTTAATTGTGGATTATTGGGTA
GTAGAAACAAGTTGGTGTTTTCATGCAAGAATGCTTGTGATGTGGAGGAAGGTAGCTTGGTGGCTAGGCTGGCTAATCTACCTCTCTTTCACGACGATAA
TACACTTCCGAAGAGATGA
AA sequence
>Lus10011724 pacid=23145617 polypeptide=Lus10011724 locus=Lus10011724.g ID=Lus10011724.BGIv1.0 annot-version=v1.0
MGNHRKSCSQGSIPFSWEDSPGVSKSIHPTPPPLSPRRRSISVPTFTVDDSARNKEKKMKMNSDNHNRSLPPPPPSSSTKLQRGSLSGKTATFGRCGVED
PFLAAYKECTKDRFRWWKLTNPNKTIFNCGLLGSRNKLVFSCKNACDVEEGSLVARLANLPLFHDDNTLPKR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10011724 0 1
AT3G13050 AtNiaP nicotinate transporter, Major ... Lus10043061 1.0 0.9882
AT2G40320 TBL33 TRICHOME BIREFRINGENCE-LIKE 33... Lus10040953 3.2 0.9824
AT3G18660 PGSIP1, GUX1 glucuronic acid substitution o... Lus10033485 4.2 0.9834
AT4G28500 NAC ANAC073, SND2, ... SECONDARY WALL-ASSOCIATED NAC ... Lus10039873 4.2 0.9830
AT1G25530 Transmembrane amino acid trans... Lus10034283 4.6 0.9812
AT1G18265 Protein of unknown function, D... Lus10007082 4.8 0.9731
AT3G16920 ATCTL2 chitinase-like protein 2 (.1) Lus10016872 5.1 0.9791
AT3G59690 IQD13 IQ-domain 13 (.1) Lus10025593 5.2 0.9805
AT5G17920 ATCIMS, ATMETS,... methionine synthesis 1, COBALA... Lus10003363 5.3 0.9828
AT1G27440 ATGUT1, IRX10, ... Exostosin family protein (.1) Lus10043326 8.0 0.9808

Lus10011724 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.