Lus10011740 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G24200 95 / 3e-24 FAD/NAD(P)-binding oxidoreductase family protein (.1), FAD/NAD(P)-binding oxidoreductase family protein (.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011742 162 / 2e-48 AT3G24200 653 / 0.0 FAD/NAD(P)-binding oxidoreductase family protein (.1), FAD/NAD(P)-binding oxidoreductase family protein (.2)
Lus10000752 161 / 2e-47 AT1G04780 863 / 0.0 Ankyrin repeat family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G051200 116 / 5e-32 AT3G24200 663 / 0.0 FAD/NAD(P)-binding oxidoreductase family protein (.1), FAD/NAD(P)-binding oxidoreductase family protein (.2)
PFAM info
Representative CDS sequence
>Lus10011740 pacid=23165894 polypeptide=Lus10011740 locus=Lus10011740.g ID=Lus10011740.BGIv1.0 annot-version=v1.0
ATGAACCCGAAGCACTCATCAGATTTGGCAGTAATGAATGAGGATGATTTTGTGAAAGCTGTAAATAATGATCTGGACCATGGATATGACCCTCGTCCAA
AGTCGAGCTTCCCGAATGGTAGCGACAGGTTTTCTCTATTTGGAGGCAACTTAACCATGTGGACCAATGAATATGTTGAGGTACCACCAAAGGTGGTAAA
GCTGGTTTCGAAGAGAACAGTGCTTCCCCTGTCCTTAATGCATGATCACGACTATGTAGTGAAACGTGTTGTTCTTAGTTCATCCTCTAGCAGGTCAAGG
AGTTAA
AA sequence
>Lus10011740 pacid=23165894 polypeptide=Lus10011740 locus=Lus10011740.g ID=Lus10011740.BGIv1.0 annot-version=v1.0
MNPKHSSDLAVMNEDDFVKAVNNDLDHGYDPRPKSSFPNGSDRFSLFGGNLTMWTNEYVEVPPKVVKLVSKRTVLPLSLMHDHDYVVKRVVLSSSSSRSR
S

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G24200 FAD/NAD(P)-binding oxidoreduct... Lus10011740 0 1
AT1G54730 Major facilitator superfamily ... Lus10029966 2.4 0.9274
AT2G42130 Plastid-lipid associated prote... Lus10016263 3.7 0.9181
AT2G47010 unknown protein Lus10000888 5.1 0.8977
AT5G57740 XBAT32 XB3 ortholog 2 in Arabidopsis ... Lus10015503 6.0 0.9000
AT2G16720 MYB AtY49, AtMYB7 ARABIDOPSIS THALIANA MYB DOMAI... Lus10028435 7.4 0.9111
AT2G29120 ATGLR2.7 GLUTAMATE RECEPTOR 2.7, gluta... Lus10026913 9.2 0.9154
AT1G54730 Major facilitator superfamily ... Lus10035354 12.6 0.8863
AT4G17890 UBP20, AGD8 ARF-GAP domain 8 (.1.2) Lus10004125 13.1 0.9053
AT4G03115 Mitochondrial substrate carrie... Lus10024769 13.2 0.9074
AT1G14740 Protein of unknown function (D... Lus10030769 14.4 0.9133

Lus10011740 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.