Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G24060 152 / 1e-48 Plant self-incompatibility protein S1 family (.1) AT5G04350 53 / 7e-10 Plant self-incompatibility protein S1 family (.1) AT4G16195 51 / 7e-09 Plant self-incompatibility protein S1 family (.1) AT1G26798 49 / 3e-08 Plant self-incompatibility protein S1 family (.1) AT5G06030 48 / 6e-08 Plant self-incompatibility protein S1 family (.1) AT1G04645 47 / 7e-08 Plant self-incompatibility protein S1 family (.1) AT1G28305 47 / 1e-07 Plant self-incompatibility protein S1 family (.1) AT5G06020 47 / 2e-07 Plant self-incompatibility protein S1 family (.1) AT3G27680 45 / 4e-07 Plant self-incompatibility protein S1 family (.1) AT3G26880 45 / 7e-07 Plant self-incompatibility protein S1 family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023675 [exp] 217 / 2e-74 AT3G24060 162 / 3e-52 Plant self-incompatibility protein S1 family (.1) Lus10017719 [exp] 174 / 1e-57 AT3G24060 157 / 4e-50 Plant self-incompatibility protein S1 family (.1) Lus10033675 [exp] 90 / 2e-24 AT3G24060 72 / 4e-17 Plant self-incompatibility protein S1 family (.1) Lus10030565 [exp] 54 / 3e-10 AT3G16970 91 / 7e-24 Plant self-incompatibility protein S1 family (.1) Lus10042506 [exp] 45 / 2e-06 AT4G16295 112 / 5e-32 S-protein homologue 1 (.1) Lus10029375 [exp] 43 / 5e-06 AT5G04347 62 / 4e-13 Plant self-incompatibility protein S1 family (.1) Lus10021633 [exp] 43 / 5e-06 AT4G29035 57 / 4e-11 Plant self-incompatibility protein S1 family (.1) Lus10030964 [exp] 43 / 6e-06 AT5G12060 102 / 2e-28 Plant self-incompatibility protein S1 family (.1) Lus10013145 [exp] 42 / 8e-06 AT4G16195 88 / 8e-23 Plant self-incompatibility protein S1 family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G175200 [exp] 186 / 3e-62 AT3G24060 177 / 2e-58 Plant self-incompatibility protein S1 family (.1) Potri.001G053100 [exp] 179 / 2e-59 AT3G24060 171 / 2e-55 Plant self-incompatibility protein S1 family (.1) Potri.001G053300 [exp] 77 / 4e-19 AT3G24060 82 / 2e-20 Plant self-incompatibility protein S1 family (.1) Potri.003G201300 [exp] 70 / 4e-16 AT2G06090 65 / 5e-14 Plant self-incompatibility protein S1 family (.1) Potri.010G008300 [exp] 66 / 1e-14 AT3G17080 74 / 8e-18 Plant self-incompatibility protein S1 family (.1) Potri.003G175100 [exp] 60 / 1e-12 ND / Potri.002G263900 [exp] 59 / 3e-12 AT3G24060 46 / 5e-07 Plant self-incompatibility protein S1 family (.1) Potri.001G053200 [exp] 59 / 3e-12 AT3G24060 56 / 1e-10 Plant self-incompatibility protein S1 family (.1) Potri.002G252500 [exp] 56 / 1e-10 AT4G16295 116 / 9e-34 S-protein homologue 1 (.1) Potri.003G175000 [exp] 53 / 7e-10 AT3G24060 46 / 7e-07 Plant self-incompatibility protein S1 family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05938 [flax] [poplar] Self-incomp_S1 Plant self-incompatibility protein S1
Representative CDS sequence Show only first row Show all	>Lus10011754 pacid=23165904 polypeptide=Lus10011754 locus=Lus10011754.g ID=Lus10011754.BGIv1.0 annot-version=v1.0 ATGCAGCTAGATTACGGTGTTCGTGTGATCAACGGCTTCACTAACAACTCATCTCTTCCCCTGGTCATATGGTGCTCATCCGGTGACAATGATCTCGGAG GTCGAGCCCTTCAGGAAGGCGAAGACTTCGGCTGGAGCGTCCGAACCAAGTTCTGGGACAGAAACAGTTTCTTGTGTACCATGAAGTGGGATGCTAGGAG GAGGAAGTTCCACGCGTTTAAGGTTCCTAGGGACGTTCAGCGATGCAGCCTTACGAGGAAGTGCTCATGGTTGGTTAGAGAGGATGGCTTCTATTTCAGC AGCGATGAAGTTAACTGGAACAAAGACTTCTCTTGGTCTTAA
AA sequence Show only first row Show all	>Lus10011754 pacid=23165904 polypeptide=Lus10011754 locus=Lus10011754.g ID=Lus10011754.BGIv1.0 annot-version=v1.0 MQLDYGVRVINGFTNNSSLPLVIWCSSGDNDLGGRALQEGEDFGWSVRTKFWDRNSFLCTMKWDARRRKFHAFKVPRDVQRCSLTRKCSWLVREDGFYFS SDEVNWNKDFSWS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G24060			Plant self-incompatibility pro...		Lus10011754 [exp]	0	1
AT3G14470			NB-ARC domain-containing disea...		Lus10022351 [exp]	2.8	0.8371
AT5G08300			Succinyl-CoA ligase, alpha sub...		Lus10010185 [exp]	3.0	0.8117
AT3G19700		IKU2	HAIKU2, Leucine-rich repeat pr...		Lus10012461 [exp]	5.5	0.7913
AT4G10940			RING/U-box protein (.1)		Lus10001535 [exp]	8.0	0.7989
AT3G11710		ATKRS-1	lysyl-tRNA synthetase 1 (.1)		Lus10001625 [exp]	8.4	0.8138
					Lus10008149 [exp]	11.7	0.7776
AT5G60250			zinc finger (C3HC4-type RING f...		Lus10036127 [exp]	15.0	0.7976
AT5G43820			Pentatricopeptide repeat (PPR)...		Lus10010662 [exp]	22.6	0.7409
					Lus10016313 [exp]	25.5	0.6857
AT1G69440		ZIP, AGO7	ZIPPY, ARGONAUTE7, Argonaute f...		Lus10037136 [exp]	28.5	0.7639

Compare expression of checked genes

Lus10011754 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.