Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G11580 50 / 8e-09 ATPMEPCRA methylesterase PCR A (.1) AT2G47030 49 / 1e-08 VGDH1 Plant invertase/pectin methylesterase inhibitor superfamily (.1) AT2G47040 48 / 7e-08 VGD1 VANGUARD1, Plant invertase/pectin methylesterase inhibitor superfamily (.1) AT5G53370 45 / 6e-07 ATPMEPCRF pectin methylesterase PCR fragment F (.1) AT1G53830 44 / 1e-06 ATPME2 pectin methylesterase 2 (.1) AT3G14310 44 / 1e-06 ATPME3 pectin methylesterase 3 (.1) AT3G49220 44 / 1e-06 Plant invertase/pectin methylesterase inhibitor superfamily (.1) AT3G05620 43 / 4e-06 Plant invertase/pectin methylesterase inhibitor superfamily (.1) AT1G11370 42 / 7e-06 Pectin lyase-like superfamily protein (.1) AT3G62170 42 / 8e-06 VGDH2 VANGUARD 1 homolog 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013344 [exp] 72 / 3e-16 AT3G14310 698 / 0.0 pectin methylesterase 3 (.1) Lus10039314 [exp] 56 / 1e-10 AT3G14310 702 / 0.0 pectin methylesterase 3 (.1) Lus10037458 [exp] 50 / 1e-08 AT3G14310 491 / 2e-170 pectin methylesterase 3 (.1) Lus10017375 [exp] 43 / 3e-06 AT3G43270 525 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Lus10001466 [exp] 43 / 5e-06 AT4G02300 299 / 1e-105 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Lus10008203 [exp] 42 / 5e-06 AT4G02320 497 / 2e-172 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Lus10029868 [exp] 42 / 6e-06 AT3G05620 684 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Lus10022412 [exp] 42 / 6e-06 AT3G49220 761 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Lus10003933 [exp] 42 / 9e-06 AT3G14310 733 / 0.0 pectin methylesterase 3 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G051400 [exp] 61 / 1e-12 AT3G14310 708 / 0.0 pectin methylesterase 3 (.1) Potri.003G072800 [exp] 59 / 4e-12 AT3G14310 795 / 0.0 pectin methylesterase 3 (.1) Potri.006G256600 [exp] 58 / 2e-11 AT3G14310 548 / 0.0 pectin methylesterase 3 (.1) Potri.006G256700 [exp] 57 / 3e-11 AT3G14310 587 / 0.0 pectin methylesterase 3 (.1) Potri.003G002650 [exp] 56 / 7e-11 AT3G14310 598 / 0.0 pectin methylesterase 3 (.1) Potri.003G002800 [exp] 56 / 9e-11 AT3G14310 592 / 0.0 pectin methylesterase 3 (.1) Potri.001G162400 [exp] 55 / 2e-10 AT3G14310 792 / 0.0 pectin methylesterase 3 (.1) Potri.001G162500 [exp] 50 / 1e-08 AT3G14310 541 / 0.0 pectin methylesterase 3 (.1) Potri.001G162600 [exp] 50 / 1e-08 AT3G14310 551 / 0.0 pectin methylesterase 3 (.1) Potri.005G022700 [exp] 47 / 2e-07 AT3G05620 704 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0268 [flax] [poplar] Pec_lyase-like PF01095 [flax] [poplar] Pectinesterase Pectinesterase
Representative CDS sequence Show only first row Show all	>Lus10011760 pacid=23165901 polypeptide=Lus10011760 locus=Lus10011760.g ID=Lus10011760.BGIv1.0 annot-version=v1.0 ATGGAATTATTGGAGGTCATTGGGAAGTCGTCAGGTCATCGTGGGGAGGTGAGCAGGAGCAGGAATTGTAGGACGGTGGGGAAGGCGGTAGCGGCAGTGC CGGAAGGGAGTAGGAGGAGGTACATGATGAGGATAAAGATCGGAGTATACAGAGAAACAATGGTGGTGCCGAAGAAGAAGAATACCAATCTTATGTTCAT CGGATTAATGAGAATGCATTGA
AA sequence Show only first row Show all	>Lus10011760 pacid=23165901 polypeptide=Lus10011760 locus=Lus10011760.g ID=Lus10011760.BGIv1.0 annot-version=v1.0 MELLEVIGKSSGHRGEVSRSRNCRTVGKAVAAVPEGSRRRYMMRIKIGVYRETMVVPKKKNTNLMFIGLMRMH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G47030		VGDH1	Plant invertase/pectin methyle...		Lus10011760 [exp]	0	1
AT3G25070		RIN4	RPM1 interacting protein 4 (.1...		Lus10006451 [exp]	4.1	0.9097
AT4G34810			SAUR-like auxin-responsive pro...		Lus10042378 [exp]	6.3	0.9058
AT2G20520		FLA6	FASCICLIN-like arabinogalactan...		Lus10033651 [exp]	9.6	0.9056
AT1G47480			alpha/beta-Hydrolases superfam...		Lus10021745 [exp]	10.2	0.8887
AT3G04730	AUX_IAA	IAA16	indoleacetic acid-induced prot...		Lus10024854 [exp]	15.6	0.9030
AT3G08610			unknown protein		Lus10010288 [exp]	19.7	0.8308
AT4G12520			Bifunctional inhibitor/lipid-t...		Lus10028929 [exp]	21.0	0.8899
AT2G39180		CCR2, ATCRR2	CRINKLY4 related 2 (.1)		Lus10036524 [exp]	29.5	0.8874
AT4G29140		ADS1	ACTIVATED DISEASE SUSCEPTIBILI...		Lus10012944 [exp]	32.1	0.8674
AT3G61640		AGP20, ATAGP20	arabinogalactan protein 20 (.1...		Lus10033939 [exp]	34.1	0.8984

Compare expression of checked genes

Lus10011760 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.