Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G05620 194 / 2e-65 PGR5 proton gradient regulation 5 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023734 [exp] 246 / 1e-85 AT2G05620 193 / 5e-65 proton gradient regulation 5 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G066900 [exp] 182 / 8e-61 AT2G05620 173 / 7e-57 proton gradient regulation 5 (.1) Potri.008G171000 [exp] 172 / 2e-56 AT2G05620 179 / 2e-59 proton gradient regulation 5 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10011777 pacid=23165554 polypeptide=Lus10011777 locus=Lus10011777.g ID=Lus10011777.BGIv1.0 annot-version=v1.0 ATGGCTGTTGCTTCCATTTCTGCAACTGGGTTGAAAGGAGGTTTAAGGTCTTCTTCATTCATCGGGGGATGGGGCACTTGTATGGGTGGAGAAGATTATC GGTCCCATCCACCCCAACAAGTCAGAATTGTGAGGAGAGCCAAGATGCTACCACCCATGATGAAGAACGTTAATGAAGGCAAGGGTCTCTTTGCTCCTGC AGTTGTTGTTGCTCGCAATCTTATTGGCAAGAAGAGGTTCAATCAGCTTCGTGGCAAAGCTATCGCCTTGCACTCCCAGGTGATTACTGAGTTCTGCAAG TCAATAGGAGCAGATGCAAAGCAAAGGCAAGGGCTGATCAGGCTGGCCAAGAAGAATGGAGAGAAACTTGGATTCCTTGCTTGA
AA sequence Show only first row Show all	>Lus10011777 pacid=23165554 polypeptide=Lus10011777 locus=Lus10011777.g ID=Lus10011777.BGIv1.0 annot-version=v1.0 MAVASISATGLKGGLRSSSFIGGWGTCMGGEDYRSHPPQQVRIVRRAKMLPPMMKNVNEGKGLFAPAVVVARNLIGKKRFNQLRGKAIALHSQVITEFCK SIGADAKQRQGLIRLAKKNGEKLGFLA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G05620		PGR5	proton gradient regulation 5 (...		Lus10011777 [exp]	0	1
AT5G24930	CO	COL4, ATCOL4	CONSTANS-like 4 (.1)		Lus10026238 [exp]	1.4	0.9504
AT1G77090			Mog1/PsbP/DUF1795-like photosy...		Lus10028633 [exp]	2.4	0.9450
AT5G13770			Pentatricopeptide repeat (PPR-...		Lus10035089 [exp]	2.4	0.9503
AT3G47070			unknown protein		Lus10040689 [exp]	4.0	0.9385
AT2G34430		LHCB1.4, LHB1B1	light-harvesting chlorophyll-p...		Lus10038489 [exp]	4.5	0.9297
AT1G06040	CO	BBX24, STO	SALT TOLERANCE, B-box domain p...		Lus10025579 [exp]	4.5	0.9374
AT4G25130		PMSR4	peptide met sulfoxide reductas...		Lus10032504 [exp]	4.6	0.9303
AT5G24930	CO	COL4, ATCOL4	CONSTANS-like 4 (.1)		Lus10042431 [exp]	4.9	0.9314
AT1G29930		LHCB1.3, CAB140...	LIGHT-HARVESTING CHLOROPHYLL A...		Lus10023322 [exp]	5.1	0.9214
AT3G01060			unknown protein		Lus10005219 [exp]	5.7	0.9289

Compare expression of checked genes

Lus10011777 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.