Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G14305 263 / 8e-91 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) AT4G04470 197 / 2e-64 PMP22 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) AT3G24570 76 / 6e-17 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) AT5G43140 67 / 1e-13 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) AT5G19750 64 / 3e-12 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) AT4G33905 58 / 2e-10 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) AT4G03410 52 / 5e-08 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) AT1G52870 50 / 2e-07 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020027 [exp] 209 / 2e-69 AT4G04470 259 / 2e-89 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) Lus10034922 [exp] 79 / 2e-18 AT3G24570 330 / 4e-116 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Lus10023648 [exp] 79 / 3e-18 AT3G24570 330 / 6e-116 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Lus10038626 [exp] 76 / 3e-17 AT3G24570 273 / 1e-93 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Lus10011679 [exp] 72 / 1e-15 AT3G24570 249 / 2e-84 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Lus10037900 [exp] 70 / 2e-14 AT3G24570 246 / 3e-82 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Lus10022130 [exp] 68 / 3e-14 AT3G24570 256 / 6e-87 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Lus10010446 [exp] 67 / 2e-13 AT5G19750 258 / 2e-86 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) Lus10012098 [exp] 67 / 3e-13 AT5G19750 259 / 4e-86 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G007100 [exp] 215 / 7e-72 AT4G04470 230 / 1e-77 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) Potri.010G068900 [exp] 214 / 1e-71 AT4G14305 252 / 1e-86 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Potri.004G008700 [exp] 209 / 3e-69 AT4G04470 209 / 2e-69 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) Potri.004G009201 [exp] 95 / 7e-26 AT4G14305 72 / 2e-17 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Potri.018G081600 [exp] 84 / 3e-20 AT3G24570 309 / 7e-108 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Potri.006G032500 [exp] 74 / 6e-16 AT5G19750 279 / 8e-94 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) Potri.018G037100 [exp] 71 / 5e-15 AT3G24570 289 / 6e-100 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Potri.016G029700 [exp] 71 / 1e-14 AT5G19750 257 / 5e-85 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) Potri.001G296400 [exp] 66 / 5e-13 AT2G14860 300 / 6e-103 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) Potri.009G090600 [exp] 65 / 7e-13 AT4G33905 299 / 1e-102 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04117 [flax] [poplar] Mpv17_PMP22 Mpv17 / PMP22 family
Representative CDS sequence Show only first row Show all	>Lus10011798 pacid=23165547 polypeptide=Lus10011798 locus=Lus10011798.g ID=Lus10011798.BGIv1.0 annot-version=v1.0 ATGTCGGACGTGGCCAAAGAGGCATGGCGGAAGTATCTGATTCAGCTTCAAGCCCACCCTCTCCGAACCAAGGCAGCAACTGCCGCTGTCTTGGCTGGCA CCAGTGATTTGATTGCTCAGAAAATTTCTGGGGCGAAGAAGATTCAGCTCCGAAGATTGTTTCTTTTCATGCTTTATGGGTTTGGTTATGCAGGACCGTT TGGGCACTTCCTCCACAAGTTCATGGATACTCTTTTCAGGGGGAAGAAGGATAACAAAACTGTCGCCAAGAAGGTACTGGTTGAACAATTAGTTATTTCT CCCTGGAACAACATGATGTTTATGTTCTACTATGGCTTGGTAATGGAAGGTAGACCGTGGAGTTCAGTGAAGAGTAAAGTCCGGAAGGATTTACCAGCTG TTCAATTCGCAGCATGGAAGGTCTGGCCTATACTCGGTTGGGTGAACCACCAGTATATCCCTTTGCAGTTCAGTGTTGTTTATGGGAGCATCCTTGGTTC ACTCTGGTATGCTCGCCACAAAAGTGTGGACACGGAAATAAAAACCAAGACAACCTAG
AA sequence Show only first row Show all	>Lus10011798 pacid=23165547 polypeptide=Lus10011798 locus=Lus10011798.g ID=Lus10011798.BGIv1.0 annot-version=v1.0 MSDVAKEAWRKYLIQLQAHPLRTKAATAAVLAGTSDLIAQKISGAKKIQLRRLFLFMLYGFGYAGPFGHFLHKFMDTLFRGKKDNKTVAKKVLVEQLVIS PWNNMMFMFYYGLVMEGRPWSSVKSKVRKDLPAVQFAAWKVWPILGWVNHQYIPLQFSVVYGSILGSLWYARHKSVDTEIKTKTT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G14305			Peroxisomal membrane 22 kDa (M...		Lus10011798 [exp]	0	1
AT1G69870		NRT1.7	nitrate transporter 1.7 (.1)		Lus10037221 [exp]	1.7	0.9179
AT5G14930		GENE101, SAG101	senescence-associated gene 101...		Lus10009502 [exp]	2.2	0.9147
AT1G77250			RING/FYVE/PHD-type zinc finger...		Lus10028655 [exp]	3.5	0.9127
AT4G27870			Vacuolar iron transporter (VIT...		Lus10037315 [exp]	5.3	0.9201
AT2G26710		CYP72B1, CYP734...	PHYB ACTIVATION TAGGED SUPPRES...		Lus10036817 [exp]	5.8	0.9358
AT1G68910		WIT2	WPP domain-interacting protein...		Lus10013053 [exp]	6.6	0.8897
AT5G09430			alpha/beta-Hydrolases superfam...		Lus10033451 [exp]	11.3	0.9009
AT4G09890			Protein of unknown function (D...		Lus10006799 [exp]	11.4	0.8997
AT1G13580		LOH3, LAG13	LAG One Homologue 3, LAG1 long...		Lus10030571 [exp]	13.1	0.9171
AT5G10110			unknown protein		Lus10022498 [exp]	13.6	0.8615

Compare expression of checked genes

Lus10011798 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.