Lus10011805 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G33460 79 / 2e-17 RIC1 ROP-interactive CRIB motif-containing protein 1 (.1)
AT4G28556 74 / 1e-15 RIC7 PAK-box/P21-Rho-binding family protein (.1)
AT1G04450 71 / 9e-15 RIC3 ROP-interactive CRIB motif-containing protein 3 (.1)
AT3G23380 68 / 6e-14 RIC5 ROP-interactive CRIB motif-containing protein 5 (.1)
AT2G20430 67 / 3e-13 RIC6 ROP-interactive CRIB motif-containing protein 6 (.1)
AT4G04900 63 / 3e-12 RIC10 ROP-interactive CRIB motif-containing protein 10 (.1)
AT1G03982 58 / 2e-10 PAK-box/P21-Rho-binding family protein (.1)
AT4G21745 54 / 6e-09 PAK-box/P21-Rho-binding family protein (.1)
AT1G61795 52 / 1e-08 PAK-box/P21-Rho-binding family protein (.1)
AT1G27380 42 / 4e-05 RIC2 ROP-interactive CRIB motif-containing protein 2 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021168 288 / 1e-96 AT2G33460 81 / 3e-17 ROP-interactive CRIB motif-containing protein 1 (.1)
Lus10018362 69 / 3e-14 AT4G04900 94 / 2e-24 ROP-interactive CRIB motif-containing protein 10 (.1)
Lus10007648 69 / 3e-14 AT4G04900 88 / 2e-22 ROP-interactive CRIB motif-containing protein 10 (.1)
Lus10006763 62 / 1e-11 AT4G04900 81 / 2e-19 ROP-interactive CRIB motif-containing protein 10 (.1)
Lus10003625 57 / 5e-10 AT4G28556 94 / 3e-24 PAK-box/P21-Rho-binding family protein (.1)
Lus10008243 54 / 5e-09 AT4G28556 94 / 3e-24 PAK-box/P21-Rho-binding family protein (.1)
Lus10020060 51 / 1e-07 AT3G54200 72 / 4e-15 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
Lus10021974 42 / 0.0002 AT2G33460 51 / 4e-08 ROP-interactive CRIB motif-containing protein 1 (.1)
Lus10041267 42 / 0.0002 AT2G33460 55 / 5e-09 ROP-interactive CRIB motif-containing protein 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G069500 108 / 5e-28 AT4G28556 99 / 1e-24 PAK-box/P21-Rho-binding family protein (.1)
Potri.008G168900 94 / 6e-23 AT2G33460 101 / 4e-26 ROP-interactive CRIB motif-containing protein 1 (.1)
Potri.004G020650 77 / 1e-17 AT4G04900 73 / 1e-16 ROP-interactive CRIB motif-containing protein 10 (.1)
Potri.011G025300 70 / 6e-15 AT4G04900 89 / 5e-23 ROP-interactive CRIB motif-containing protein 10 (.1)
Potri.002G035500 71 / 1e-14 AT2G20430 105 / 1e-27 ROP-interactive CRIB motif-containing protein 6 (.1)
Potri.005G227500 60 / 1e-10 AT4G28556 106 / 5e-28 PAK-box/P21-Rho-binding family protein (.1)
Potri.002G233400 42 / 0.0001 AT5G16490 89 / 1e-22 ROP-interactive CRIB motif-containing protein 4 (.1)
Potri.014G147000 40 / 0.0005 AT5G16490 76 / 8e-18 ROP-interactive CRIB motif-containing protein 4 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00786 PBD P21-Rho-binding domain
Representative CDS sequence
>Lus10011805 pacid=23165519 polypeptide=Lus10011805 locus=Lus10011805.g ID=Lus10011805.BGIv1.0 annot-version=v1.0
ATGACGACAAAAGTGAAAGGTCTTCTTAAAGGGCTTAAGTATTCCGTATCGCATAATATTTTTAATGAGAAAGAACAAGACATCGAGATTGGGTTTCCTA
CCGATGTAAAACATGTTGCACATATCGGATCTGACGGCCCTTCTTCCACCACCCCTAGTTGGATGAATGAGTTCAAATCTACCCCAGAGACGACGATGAG
TGGCCCTTTGAATCCTACAGATGATCTCAAGAGCATTGCTTCCCCAACAAAAGCACAATCTGAAGCTGGTGGGTCCACCCACAGGAAGCACAGGTCAAGG
CGCTCATCCAGCGACGCGCCAAAGCACACGAGACGAGGATCCAATGCCAGCAGTGCAGCCGGTTCGCCGGTGGGTTCACCAAAAGCCGGCGACGGCGAGA
AGAAGTCGAGGCGCCACCGCTCTTCCAACAACATGGCGATGGGATCCCCAGCCAGGGAGACGTCGACTGGAGGCAGCGTGAAAGCGAGGAAGAGCAAGAA
ATCATCTTCGTCGTCAGCCAATCAGGGCGACGAATCCCCTCCCAGTGTTGACCAGCCATCCATCCCGAAGCATTCTCGCACTAGGAAATCGAGAGCCAAG
TCAAAGGAGCAGCCGGATAATTCCGCTCCCGCCGACGGGCTTCCTCGCCCCCGACAGCCCCCCCCCCCCCACGGGCGGGAGAGACCCCAAAAAAGGCCCC
CCCCGCCGGCCATCTAA
AA sequence
>Lus10011805 pacid=23165519 polypeptide=Lus10011805 locus=Lus10011805.g ID=Lus10011805.BGIv1.0 annot-version=v1.0
MTTKVKGLLKGLKYSVSHNIFNEKEQDIEIGFPTDVKHVAHIGSDGPSSTTPSWMNEFKSTPETTMSGPLNPTDDLKSIASPTKAQSEAGGSTHRKHRSR
RSSSDAPKHTRRGSNASSAAGSPVGSPKAGDGEKKSRRHRSSNNMAMGSPARETSTGGSVKARKSKKSSSSSANQGDESPPSVDQPSIPKHSRTRKSRAK
SKEQPDNSAPADGLPRPRQPPPPHGRERPQKRPPPPAI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G33460 RIC1 ROP-interactive CRIB motif-con... Lus10011805 0 1
AT1G05200 GLUR3, ATGLR3.4 glutamate receptor 3.4 (.1.2) Lus10039671 2.4 0.8852
AT1G65480 FT FLOWERING LOCUS T, PEBP (phosp... Lus10013532 3.6 0.9047
AT4G16360 5'-AMP-activated protein kinas... Lus10012343 4.5 0.8745
AT2G36870 XTH32 xyloglucan endotransglucosylas... Lus10001396 6.9 0.8714
AT2G20610 RTY1, RTY, HLS3... SUPERROOT 1, ROOTY 1, ROOTY, H... Lus10018626 7.1 0.8755
AT3G43240 ARID ARID/BRIGHT DNA-binding domain... Lus10027658 8.0 0.8546
AT4G12320 CYP706A6 "cytochrome P450, family 706, ... Lus10032217 8.9 0.8718
AT2G23790 Protein of unknown function (D... Lus10016305 16.0 0.8658
AT1G55090 carbon-nitrogen hydrolase fami... Lus10003203 18.5 0.7937
AT4G12300 CYP706A4 "cytochrome P450, family 706, ... Lus10032216 19.8 0.8695

Lus10011805 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.