Lus10011807 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G20450 221 / 1e-75 Ribosomal protein L14 (.1)
AT4G27090 219 / 5e-75 Ribosomal protein L14 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021170 261 / 1e-91 AT2G20450 218 / 1e-74 Ribosomal protein L14 (.1)
Lus10024918 254 / 8e-89 AT2G20450 224 / 3e-77 Ribosomal protein L14 (.1)
Lus10008246 253 / 2e-88 AT2G20450 228 / 8e-79 Ribosomal protein L14 (.1)
Lus10003627 154 / 6e-50 AT4G27090 139 / 2e-44 Ribosomal protein L14 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G168600 234 / 3e-81 AT4G27090 230 / 2e-79 Ribosomal protein L14 (.1)
Potri.002G035700 231 / 5e-80 AT4G27090 234 / 8e-81 Ribosomal protein L14 (.1)
Potri.005G227300 231 / 8e-80 AT4G27090 235 / 3e-81 Ribosomal protein L14 (.1)
Potri.010G069900 228 / 8e-79 AT4G27090 228 / 2e-78 Ribosomal protein L14 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0107 KOW PF01929 Ribosomal_L14e Ribosomal protein L14
Representative CDS sequence
>Lus10011807 pacid=23165548 polypeptide=Lus10011807 locus=Lus10011807.g ID=Lus10011807.BGIv1.0 annot-version=v1.0
ATGGGTTTCAAAAGATACGTCGAGATCGGACGCGTTGCTCTGATCAACTACGGGAAGGACTACGGAAAGCTCGTTGTCATTGTCGATGTCGTCGACCAAA
ATCGGGCTCTAGTTGATTCACCTGATATGGTTAGGAGCCAAATCAACTTCAAGAGGCTTACTCTCACCGACATCAAGATTGAGATTAACAGAGTTCCCAG
GAAGAAGACTCTTATCGAAGCCATGGAGAAGGCTGATGTTAAAGGAAAGTGGGAGAACAGCTCTTGGGGCCGCAAGTTGATCGTTAAGCAGAGGAGGGCT
GCTCTCACCGACTTCGACAGGTTCAAGGTTATGTTGGCAAAGATCAAGAGAGGAGGATTGATCAAGCAAGAGCTTGCCAAGCTGAAGAAGACTGCTGCTT
AG
AA sequence
>Lus10011807 pacid=23165548 polypeptide=Lus10011807 locus=Lus10011807.g ID=Lus10011807.BGIv1.0 annot-version=v1.0
MGFKRYVEIGRVALINYGKDYGKLVVIVDVVDQNRALVDSPDMVRSQINFKRLTLTDIKIEINRVPRKKTLIEAMEKADVKGKWENSSWGRKLIVKQRRA
ALTDFDRFKVMLAKIKRGGLIKQELAKLKKTAA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G20450 Ribosomal protein L14 (.1) Lus10011807 0 1
AT2G44120 Ribosomal protein L30/L7 famil... Lus10004220 1.7 0.9789
AT1G67430 Ribosomal protein L22p/L17e fa... Lus10006421 3.5 0.9708
AT1G09590 Translation protein SH3-like f... Lus10030607 4.9 0.9662
AT1G48830 Ribosomal protein S7e family p... Lus10023638 5.9 0.9627
AT1G48830 Ribosomal protein S7e family p... Lus10028789 6.0 0.9628
AT3G06700 Ribosomal L29e protein family ... Lus10016875 6.9 0.9593
AT5G35530 Ribosomal protein S3 family pr... Lus10030503 7.5 0.9643
AT5G59850 Ribosomal protein S8 family pr... Lus10023429 7.6 0.9439
AT4G16720 Ribosomal protein L23/L15e fam... Lus10007805 8.7 0.9637
AT2G43110 unknown protein Lus10001158 9.2 0.9342

Lus10011807 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.