Plant FIBer expression Database

Lus10011813 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G23325 181 / 2e-61 Splicing factor 3B subunit 5/RDS3 complex subunit 10 (.1)
AT4G14342 180 / 3e-61 Splicing factor 3B subunit 5/RDS3 complex subunit 10 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021176
[exp]
38 / 0.0005 AT4G14350 861 / 0.0 AGC (cAMP-dependent, cGMP-dependent and protein kinase C) kinase family protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G168000
[exp]
183 / 4e-62 AT3G23325 179 / 1e-60 Splicing factor 3B subunit 5/RDS3 complex subunit 10 (.1)
Potri.010G070500
[exp]
182 / 8e-62 AT3G23325 178 / 3e-60 Splicing factor 3B subunit 5/RDS3 complex subunit 10 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF07189 SF3b10 Splicing factor 3B subunit 10 (SF3b10)
Representative CDS sequence
>Lus10011813 pacid=23165528 polypeptide=Lus10011813 locus=Lus10011813.g ID=Lus10011813.BGIv1.0 annot-version=v1.0
ATGCAGGCCAGTGATAGGTTTAACATCAATTCCCAGCTCGAACATCTCCAGGCAAAGTACGTCGGCACTGGCCACGCCGATTTGAACAGATTCGAGTGGG
CGGTAAACATCCAGCGTGACAGCTATGCTTCCTATGTTGGACACTACCCTATGTTAGCTTACTTTGCTGTTGCTGAAAACGAGTCTATTGGAAGAGAGCG
CTACAACTTCATGCAGAAAATGCTTTTGCCGTGTGGCCTACCACCAGAGAGAGAGGACGAGTGA
AA sequence
>Lus10011813 pacid=23165528 polypeptide=Lus10011813 locus=Lus10011813.g ID=Lus10011813.BGIv1.0 annot-version=v1.0
MQASDRFNINSQLEHLQAKYVGTGHADLNRFEWAVNIQRDSYASYVGHYPMLAYFAVAENESIGRERYNFMQKMLLPCGLPPEREDE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G23325 Splicing factor 3B subunit 5/R... Lus10011813
[exp]
0 1
AT2G37640 ATHEXPALPHA1.9,... ARABIDOPSIS THALIANA EXPANSIN ... Lus10002638
[exp]
5.3 0.8791
AT1G18390 Protein kinase superfamily pro... Lus10027117
[exp]
8.8 0.8484
AT1G20510 OPCL1 OPC-8:0 CoA ligase1 (.1.2) Lus10037934
[exp]
10.4 0.8406
Lus10031873
[exp]
10.6 0.8593
AT5G62140 unknown protein Lus10038887
[exp]
11.2 0.8368
AT1G32560 AtLEA4-1 Late Embryogenesis Abundant 4-... Lus10040088
[exp]
11.8 0.8164
AT1G18140 LAC1, ATLAC1 laccase 1 (.1) Lus10009827
[exp]
14.5 0.8050
AT1G06060 LisH and RanBPM domains contai... Lus10005633
[exp]
14.9 0.8121
AT5G39030 Protein kinase superfamily pro... Lus10027116
[exp]
15.1 0.8154
AT4G27680 P-loop containing nucleoside t... Lus10008835
[exp]
20.1 0.8120

Lus10011813 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.