Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G04530 54 / 3e-10 ATPPCK2, PEPCK2, PPCK2 phosphoenolpyruvate carboxylase kinase 2 (.1) AT1G08650 51 / 3e-09 ATPPCK1, PPCK1 phosphoenolpyruvate carboxylase kinase 1 (.1.2) AT1G50700 42 / 7e-06 CPK33 calcium-dependent protein kinase 33 (.1) AT1G76040 41 / 1e-05 CPK29 calcium-dependent protein kinase 29 (.1.2) AT4G04700 40 / 3e-05 CPK27 calcium-dependent protein kinase 27 (.1) AT3G20410 39 / 4e-05 CPK9 calmodulin-domain protein kinase 9 (.1) AT4G04695 39 / 6e-05 CPK31 calcium-dependent protein kinase 31 (.1) AT4G21940 39 / 6e-05 CPK15 calcium-dependent protein kinase 15 (.1.2) AT5G12480 39 / 6e-05 CPK7 calmodulin-domain protein kinase 7 (.1.2) AT5G04870 39 / 8e-05 AK1, ATCPK1, CPK1 calcium dependent protein kinase 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021190 [exp] 93 / 3e-25 AT3G04530 186 / 1e-58 phosphoenolpyruvate carboxylase kinase 2 (.1) Lus10014657 [exp] 55 / 2e-10 AT1G08650 351 / 2e-122 phosphoenolpyruvate carboxylase kinase 1 (.1.2) Lus10042560 [exp] 49 / 2e-08 AT1G08650 344 / 1e-119 phosphoenolpyruvate carboxylase kinase 1 (.1.2) Lus10042370 [exp] 43 / 3e-06 AT3G57530 820 / 0.0 calcium-dependent protein kinase 32 (.1) Lus10026742 [exp] 42 / 8e-06 AT3G57530 793 / 0.0 calcium-dependent protein kinase 32 (.1) Lus10032640 [exp] 40 / 2e-05 AT3G20410 790 / 0.0 calmodulin-domain protein kinase 9 (.1) Lus10029547 [exp] 40 / 2e-05 AT1G35670 790 / 0.0 calcium-dependent protein kinase 2 (.1) Lus10017251 [exp] 40 / 3e-05 AT1G76040 807 / 0.0 calcium-dependent protein kinase 29 (.1.2) Lus10005619 [exp] 40 / 3e-05 AT1G76040 773 / 0.0 calcium-dependent protein kinase 29 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G166500 [exp] 90 / 1e-23 AT1G08650 287 / 2e-97 phosphoenolpyruvate carboxylase kinase 1 (.1.2) Potri.010G071400 [exp] 87 / 9e-23 AT1G08650 298 / 1e-101 phosphoenolpyruvate carboxylase kinase 1 (.1.2) Potri.019G018100 [exp] 56 / 4e-11 AT3G04530 379 / 2e-133 phosphoenolpyruvate carboxylase kinase 2 (.1) Potri.013G046100 [exp] 52 / 1e-09 AT3G04530 366 / 1e-128 phosphoenolpyruvate carboxylase kinase 2 (.1) Potri.001G257100 [exp] 42 / 4e-06 AT5G12480 903 / 0.0 calmodulin-domain protein kinase 7 (.1.2) Potri.005G251500 [exp] 42 / 5e-06 AT1G12680 662 / 0.0 phosphoenolpyruvate carboxylase-related kinase 2 (.1) Potri.016G054600 [exp] 42 / 7e-06 AT3G57530 864 / 0.0 calcium-dependent protein kinase 32 (.1) Potri.006G052900 [exp] 41 / 1e-05 AT3G57530 863 / 0.0 calcium-dependent protein kinase 32 (.1) Potri.016G066700 [exp] 40 / 3e-05 AT3G10660 834 / 0.0 calmodulin-domain protein kinase cdpk isoform 2 (.1) Potri.010G031800 [exp] 39 / 5e-05 AT5G18700 1791 / 0.0 RUNKEL, EMBRYO DEFECTIVE 3013, Protein kinase family protein with ARM repeat domain (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [flax] [poplar] PKinase PF00069 [flax] [poplar] Pkinase Protein kinase domain
Representative CDS sequence Show only first row Show all	>Lus10011823 pacid=23165562 polypeptide=Lus10011823 locus=Lus10011823.g ID=Lus10011823.BGIv1.0 annot-version=v1.0 ATGAGCGAAGCATTGGGAAGAGACTACCAAATCTGCGACGAGATCGGCCGGGGACGCTTCGGAACCGTATTCAAGTGCGATTCCCGCTCCACTGGCGAAT CCTTCGCCGTCAAATCCATCGATAAATCCCTCACCGCCGGCGAATCCCTGCACCCACAGGATCCCTCACCGCCGGCGATTCCCTGGACGCCCAGTGCCTC TTGA
AA sequence Show only first row Show all	>Lus10011823 pacid=23165562 polypeptide=Lus10011823 locus=Lus10011823.g ID=Lus10011823.BGIv1.0 annot-version=v1.0 MSEALGRDYQICDEIGRGRFGTVFKCDSRSTGESFAVKSIDKSLTAGESLHPQDPSPPAIPWTPSAS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G08650		ATPPCK1, PPCK1	phosphoenolpyruvate carboxylas...		Lus10011823 [exp]	0	1
AT4G35070			SBP (S-ribonuclease binding pr...		Lus10017276 [exp]	8.9	0.6568
AT1G47840		HXK3	hexokinase 3 (.1)		Lus10002041 [exp]	11.3	0.6937
AT4G19550			zinc ion binding;transcription...		Lus10006630 [exp]	13.1	0.7091
AT4G04480			unknown protein		Lus10015548 [exp]	19.2	0.6834
AT1G05370			Sec14p-like phosphatidylinosit...		Lus10021919 [exp]	30.5	0.6414
AT5G39760	ZF_HD	ATHB23, ZHD10	ZINC FINGER HOMEODOMAIN 10, ho...		Lus10005242 [exp]	35.8	0.6903
AT4G02590	bHLH	bHLH059, UNE12	unfertilized embryo sac 12, ba...		Lus10002720 [exp]	38.7	0.6495
					Lus10019329 [exp]	47.7	0.6126
AT1G53900			Eukaryotic translation initiat...		Lus10037452 [exp]	52.5	0.6426
AT5G44440			FAD-binding Berberine family p...		Lus10003646 [exp]	64.5	0.6352

Compare expression of checked genes

Lus10011823 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.