Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G33270 255 / 4e-83 AtCDC20.1, CDC20.1 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) AT4G33260 246 / 2e-79 AtCDC20.2, CDC20.2 cell division cycle 20.2, Transducin family protein / WD-40 repeat family protein (.1.2) AT5G27080 230 / 3e-73 AtCDC20.3 cell division cycle 20.3, Transducin family protein / WD-40 repeat family protein (.1) AT5G27570 228 / 7e-73 AtCDC20.5 cell division cycle 20.5, Transducin/WD40 repeat-like superfamily protein (.1) AT5G27945 223 / 1e-70 Transducin/WD40 repeat-like superfamily protein (.1) AT5G26900 221 / 8e-70 AtCDC20.4 cell division cycle 20.4, Transducin family protein / WD-40 repeat family protein (.1) AT5G13840 156 / 1e-44 FZR3 FIZZY-related 3 (.1.2) AT4G11920 153 / 1e-43 FZR1, CCS52A2 FIZZY-RELATED 1, cell cycle switch protein 52 A2 (.1) AT4G22910 153 / 1e-43 CCS52A1, FZR2 cell cycle switch protein 52 A1, FIZZY-related 2 (.1) AT2G21390 58 / 2e-09 Coatomer, alpha subunit (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034687 [exp] 286 / 3e-95 AT4G33270 620 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10037595 [exp] 274 / 1e-93 AT4G33270 402 / 2e-141 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10037593 [exp] 276 / 3e-91 AT4G33270 728 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10006851 [exp] 273 / 5e-90 AT4G33270 728 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10006853 [exp] 279 / 2e-88 AT4G33270 729 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10042765 [exp] 263 / 1e-86 AT4G33270 542 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10042748 [exp] 258 / 3e-80 AT4G33270 592 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10025838 [exp] 199 / 3e-64 AT4G33270 295 / 3e-99 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10029716 [exp] 189 / 3e-61 AT4G33270 193 / 1e-60 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G118400 [exp] 255 / 4e-83 AT4G33270 771 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Potri.013G048900 [exp] 242 / 6e-78 AT4G33270 766 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Potri.019G021800 [exp] 242 / 7e-78 AT4G33270 767 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Potri.016G068700 [exp] 227 / 3e-72 AT4G33270 607 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Potri.015G110300 [exp] 156 / 5e-45 AT4G33270 363 / 5e-122 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Potri.008G057500 [exp] 156 / 1e-44 AT5G13840 705 / 0.0 FIZZY-related 3 (.1.2) Potri.001G112700 [exp] 152 / 5e-43 AT4G22910 705 / 0.0 cell cycle switch protein 52 A1, FIZZY-related 2 (.1) Potri.010G202100 [exp] 150 / 2e-42 AT5G13840 707 / 0.0 FIZZY-related 3 (.1.2) Potri.003G119500 [exp] 150 / 3e-42 AT4G22910 702 / 0.0 cell cycle switch protein 52 A1, FIZZY-related 2 (.1) Potri.005G148500 [exp] 56 / 8e-09 AT3G49660 503 / 0.0 human WDR5 \(WD40 repeat\) homolog a, Transducin/WD40 repeat-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0186 [flax] [poplar] Beta_propeller PF00400 [flax] [poplar] WD40 WD domain, G-beta repeat
Representative CDS sequence Show only first row Show all	>Lus10011833 pacid=23169270 polypeptide=Lus10011833 locus=Lus10011833.g ID=Lus10011833.BGIv1.0 annot-version=v1.0 ATGGATGATTTTTACTTCAACATACTGGATTGGGGCATCAATAATGTTCTTGGATTAGCACTAGATTGCACAGTTCAACTGTGGGATGCCTCCTATGGCT CTCCTTCCGAGCTTGTCACTGTCGATGAAGAGCTCAACCCTGTTACGAGCGTTAGCTGGGCTCCGGATGGCTGCCAGATCGCCGTCGGGTTGAACAACTC CGAAGTCCAATTGTGGGACTATACTTCTAACAAACTGGCAGCCACAGATGCCGAGCCTTCCAACCCCCGACCGACTCAGTATCTTCACAGGCTCGAGGAC CATACCTCAGCAGTAAAGGCTCTAGCTTGGTGTCCATTCCAGCGAAACTTGGTCGCTACAGGAGGCGGCGGAGAAGACAAGACAATCAAGTTCTGGAACA GCCAGACCGGTGCTTGCTTGAACTCGGTGGACACGGGCTCTCAGGTCTGTGCATTGCTGCGGAACAAGCACGAGAAGGAACTTTTATGCTCTCATGGGTT CCCCGGAAATCAGCTTACCTTGTGGAAGTATCCATCCATGGTGAAGATTGCAGAGCTTACTGGCCGTACTGCCAGGGTCCTGTTCATGGCTCAGAGTCCA GATGGATGCACGGTGGCTTCCGCAGCAGGGGATGAAAATCTGATGGTCTGGTACGTGTTTGGGGATCCTGCTACGAAGAAATCTGCTAGGAAAGCGAATC CGGAGCCCTTCTCTTGGACGAATCGATGCACCATCCGGTGA
AA sequence Show only first row Show all	>Lus10011833 pacid=23169270 polypeptide=Lus10011833 locus=Lus10011833.g ID=Lus10011833.BGIv1.0 annot-version=v1.0 MDDFYFNILDWGINNVLGLALDCTVQLWDASYGSPSELVTVDEELNPVTSVSWAPDGCQIAVGLNNSEVQLWDYTSNKLAATDAEPSNPRPTQYLHRLED HTSAVKALAWCPFQRNLVATGGGGEDKTIKFWNSQTGACLNSVDTGSQVCALLRNKHEKELLCSHGFPGNQLTLWKYPSMVKIAELTGRTARVLFMAQSP DGCTVASAAGDENLMVWYVFGDPATKKSARKANPEPFSWTNRCTIR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G33270		AtCDC20.1, CDC2...	cell division cycle 20.1, Tran...		Lus10011833 [exp]	0	1
AT5G56110	MYB	MS188, ATMYB80,...	MALE STERILE 188, ARABIDOPSIS ...		Lus10008353 [exp]	5.7	0.8023
AT1G58470		XF41, ATRBP1	RNA-binding protein 1 (.1)		Lus10007721 [exp]	15.9	0.7994
AT1G06450			Polynucleotidyl transferase, r...		Lus10008043 [exp]	23.7	0.7928
AT5G40530			S-adenosyl-L-methionine-depend...		Lus10002522 [exp]	42.7	0.7543
AT3G20390			endoribonuclease L-PSP family ...		Lus10021523 [exp]	49.0	0.7714
AT3G19184	B3		AP2/B3-like transcriptional fa...		Lus10019871 [exp]	56.5	0.7612
AT3G07590			Small nuclear ribonucleoprotei...		Lus10025186 [exp]	57.3	0.7628
AT5G64320			Pentatricopeptide repeat (PPR)...		Lus10038804 [exp]	65.5	0.7527
AT3G45900			Ribonuclease P protein subunit...		Lus10034732 [exp]	82.8	0.7545
AT2G45460	FHA		SMAD/FHA domain-containing pro...		Lus10009303 [exp]	96.3	0.7018

Compare expression of checked genes

Lus10011833 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.