Lus10011837 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G48140 152 / 1e-49 DPMS3 dolichol phosphate mannose synthase 3, dolichol-phosphate mannosyltransferase-related (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022770 177 / 8e-60 AT1G48140 150 / 4e-49 dolichol phosphate mannose synthase 3, dolichol-phosphate mannosyltransferase-related (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G245800 147 / 4e-47 AT1G48140 155 / 1e-50 dolichol phosphate mannose synthase 3, dolichol-phosphate mannosyltransferase-related (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF08285 DPM3 Dolichol-phosphate mannosyltransferase subunit 3 (DPM3)
Representative CDS sequence
>Lus10011837 pacid=23169189 polypeptide=Lus10011837 locus=Lus10011837.g ID=Lus10011837.BGIv1.0 annot-version=v1.0
ATGAAGCATATATTCAAGATTCTAGCATTGGTGGCTGCCATTTCTGCCTTCTGGATTGGTCTCTTGCAGGCATCCGTGGTGCCTCGTACCCATACTTGGT
TGCTGCCGGTTTATCTTATTGTGTCATTGGGATGCTATGGCTTACTGATGGTTGGAGTAGGATTATTAAAGTTCCCAACTTGTCCTCATGAGGCAGTGCT
TTTACAGCAGGACATTACTGAGGCAAAAGGGTTCCTGAAGGAGAAAGGAGTTGATGTTGGTTCAGAATGA
AA sequence
>Lus10011837 pacid=23169189 polypeptide=Lus10011837 locus=Lus10011837.g ID=Lus10011837.BGIv1.0 annot-version=v1.0
MKHIFKILALVAAISAFWIGLLQASVVPRTHTWLLPVYLIVSLGCYGLLMVGVGLLKFPTCPHEAVLLQQDITEAKGFLKEKGVDVGSE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G48140 DPMS3 dolichol phosphate mannose syn... Lus10011837 0 1
AT5G25265 unknown protein Lus10005347 4.6 0.8826
AT2G37550 ASP1, AGD7 yeast pde1 suppressor 1, ARF-G... Lus10023766 5.9 0.8524
AT2G02970 GDA1/CD39 nucleoside phosphata... Lus10012825 6.6 0.8682
AT3G54300 ATVAMP727 vesicle-associated membrane pr... Lus10034145 9.0 0.8487
AT1G36730 Translation initiation factor ... Lus10000448 12.0 0.8235
AT5G21090 Leucine-rich repeat (LRR) fami... Lus10026751 17.0 0.8354
AT5G10830 S-adenosyl-L-methionine-depend... Lus10002994 19.0 0.8556
AT2G17990 unknown protein Lus10041920 19.4 0.8564
AT5G47390 MYB myb-like transcription factor ... Lus10004248 21.1 0.8522
AT5G63910 FCLY farnesylcysteine lyase (.1) Lus10031378 22.3 0.8502

Lus10011837 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.