Lus10011848 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10011848 pacid=23169191 polypeptide=Lus10011848 locus=Lus10011848.g ID=Lus10011848.BGIv1.0 annot-version=v1.0
ATGGCTACTGGTCCATCAATAGAACCAATCCCTCCACGCGAGCTAACATTCAAACCAAAACCACACCTAACAAAATATGTCACTCTTCAAATACTCCAAC
ACTGCCCCAGAAACAGAACCTATACAACAATGCTTCATTCATCCCGACAGCCGTATGGCGGTCACCCTCATCTAAGTGGTGCTTTCGGGTCGATTCCTTA
TGAATGGGAAGAGGTGGACGTTAAGGGATATGTCAAGTTAGAAGCTTCATATGTGCGCGCCGATCACAACTTCCTCCCCGACAGTGTCAAGTTAGAAGCT
TTATATGTGCGCGCTGATCATACCCTCCTCCCCCAACAGTGCCAAGTTAGAAGCTTCACATGTGCGCGCCAGTCACACCCGTCCTCCCCCAACAGTGGCA
CCATAATGAGAGATGTCCTTCGCCTTTGCGATTTGACTTGA
AA sequence
>Lus10011848 pacid=23169191 polypeptide=Lus10011848 locus=Lus10011848.g ID=Lus10011848.BGIv1.0 annot-version=v1.0
MATGPSIEPIPPRELTFKPKPHLTKYVTLQILQHCPRNRTYTTMLHSSRQPYGGHPHLSGAFGSIPYEWEEVDVKGYVKLEASYVRADHNFLPDSVKLEA
LYVRADHTLLPQQCQVRSFTCARQSHPSSPNSGTIMRDVLRLCDLT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10011848 0 1
AT4G01830 ABCB5, PGP5 ATP-binding cassette B5, P-gly... Lus10004529 2.4 1.0000
Lus10011759 3.9 1.0000
Lus10011496 4.0 1.0000
AT2G20420 ATP citrate lyase (ACL) family... Lus10024923 5.5 1.0000
AT4G00750 S-adenosyl-L-methionine-depend... Lus10027433 6.5 1.0000
Lus10013545 6.9 1.0000
AT1G26480 GF14IOTA, GRF12 general regulatory factor 12 (... Lus10026660 7.3 1.0000
Lus10024550 7.5 1.0000
AT4G24975 Plant self-incompatibility pro... Lus10032383 7.7 1.0000
Lus10017303 9.2 1.0000

Lus10011848 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.