Lus10011852 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G26830 96 / 5e-24 O-Glycosyl hydrolases family 17 protein (.1)
AT5G55180 91 / 3e-22 O-Glycosyl hydrolases family 17 protein (.1.2)
AT2G05790 82 / 4e-19 O-Glycosyl hydrolases family 17 protein (.1)
AT5G20560 77 / 1e-17 Glycosyl hydrolase superfamily protein (.1)
AT4G14080 76 / 7e-17 MEE48 maternal effect embryo arrest 48, O-Glycosyl hydrolases family 17 protein (.1)
AT5G58480 73 / 8e-16 O-Glycosyl hydrolases family 17 protein (.1)
AT2G16230 73 / 9e-16 O-Glycosyl hydrolases family 17 protein (.1)
AT3G07320 71 / 4e-15 O-Glycosyl hydrolases family 17 protein (.1)
AT4G34480 71 / 6e-15 O-Glycosyl hydrolases family 17 protein (.1)
AT2G26600 69 / 2e-14 Glycosyl hydrolase superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004391 142 / 3e-41 AT5G55180 602 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2)
Lus10018306 129 / 3e-36 AT5G55180 632 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2)
Lus10040600 128 / 7e-36 AT5G55180 630 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2)
Lus10032562 105 / 2e-27 AT5G55180 642 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2)
Lus10015151 84 / 2e-19 AT2G05790 731 / 0.0 O-Glycosyl hydrolases family 17 protein (.1)
Lus10038211 75 / 2e-16 AT3G07320 614 / 0.0 O-Glycosyl hydrolases family 17 protein (.1)
Lus10025892 74 / 4e-16 AT3G07320 545 / 0.0 O-Glycosyl hydrolases family 17 protein (.1)
Lus10042269 74 / 6e-16 AT5G58480 606 / 0.0 O-Glycosyl hydrolases family 17 protein (.1)
Lus10001660 70 / 1e-14 AT1G32860 462 / 8e-163 Glycosyl hydrolase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G094400 100 / 3e-25 AT5G55180 635 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2)
Potri.002G247900 82 / 4e-19 AT3G07320 653 / 0.0 O-Glycosyl hydrolases family 17 protein (.1)
Potri.002G224600 81 / 1e-18 AT2G05790 750 / 0.0 O-Glycosyl hydrolases family 17 protein (.1)
Potri.002G247800 77 / 3e-17 AT3G07320 632 / 0.0 O-Glycosyl hydrolases family 17 protein (.1)
Potri.008G055900 74 / 2e-16 AT3G55430 494 / 8e-174 O-Glycosyl hydrolases family 17 protein (.1)
Potri.014G158400 74 / 4e-16 AT2G05790 751 / 0.0 O-Glycosyl hydrolases family 17 protein (.1)
Potri.009G076500 71 / 3e-15 AT5G58480 630 / 0.0 O-Glycosyl hydrolases family 17 protein (.1)
Potri.010G203800 71 / 5e-15 AT3G55430 354 / 2e-118 O-Glycosyl hydrolases family 17 protein (.1)
Potri.001G192200 71 / 6e-15 AT3G15800 514 / 0.0 Glycosyl hydrolase superfamily protein (.1)
Potri.018G129500 70 / 8e-15 AT2G26600 543 / 0.0 Glycosyl hydrolase superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0058 Glyco_hydro_tim PF00332 Glyco_hydro_17 Glycosyl hydrolases family 17
Representative CDS sequence
>Lus10011852 pacid=23169245 polypeptide=Lus10011852 locus=Lus10011852.g ID=Lus10011852.BGIv1.0 annot-version=v1.0
ATGGCTACCTTCTCCAAGATTCCAATGTCATTGTTCATCCTCCTAGCTCTCATCTGCACTTTGGTTCCCGCAGACGCAGCTGTTGAAGGAAGATTCATCG
GAGTCAACTACGGCAGACTCGCCACCAGCCTACCCTCACCGGCCCAAGTAGTAGAGCTCCTCAAATCTCAAGGAATCACCTTAGTCAAGATCTTCGACGC
CAACTCCGATGTCTTCACAGCCCTCGCCGGCTCCAACATCTCCAACATCTCCGTCACCGTTTGTCTTCCCAACGGGTTTGTCTCTGCCGCTGCCGCCGAC
CAAACCGTTGCCGACTACTGGGTCCACTCCAACATCTCCCCTTTCTACACTCTTCCACCAATTTTGAAGCCATCGCCATCGGGAACGAGTTTGCCGTCCC
TTATCTTGTACCGGCGATGA
AA sequence
>Lus10011852 pacid=23169245 polypeptide=Lus10011852 locus=Lus10011852.g ID=Lus10011852.BGIv1.0 annot-version=v1.0
MATFSKIPMSLFILLALICTLVPADAAVEGRFIGVNYGRLATSLPSPAQVVELLKSQGITLVKIFDANSDVFTALAGSNISNISVTVCLPNGFVSAAAAD
QTVADYWVHSNISPFYTLPPILKPSPSGTSLPSLILYRR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G26830 O-Glycosyl hydrolases family 1... Lus10011852 0 1
AT5G36930 Disease resistance protein (TI... Lus10005827 2.8 0.7574
AT1G62510 Bifunctional inhibitor/lipid-t... Lus10001493 5.6 0.7711
AT4G37110 Zinc-finger domain of monoamin... Lus10021004 8.4 0.7103
AT3G46570 Glycosyl hydrolase superfamily... Lus10000070 11.9 0.7196
Lus10024012 16.6 0.6972
AT5G06210 RNA binding (RRM/RBD/RNP motif... Lus10004224 17.3 0.6577
AT4G16270 Peroxidase superfamily protein... Lus10017069 22.3 0.7110
Lus10004902 23.3 0.6574
Lus10038003 24.7 0.6616
AT5G52850 Pentatricopeptide repeat (PPR)... Lus10038834 25.0 0.6493

Lus10011852 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.