Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G14470 53 / 2e-08 NB-ARC domain-containing disease resistance protein (.1) AT3G12610 52 / 2e-08 DRT100 DNA-DAMAGE REPAIR/TOLERATION 100, Leucine-rich repeat (LRR) family protein (.1) AT1G09970 50 / 1e-07 RLK7, LRRXI-23 ,LRR XI-23 receptor-like kinase 7, Leucine-rich receptor-like protein kinase family protein (.1.2) AT1G28340 47 / 2e-06 AtRLP4 receptor like protein 4 (.1) AT1G69550 44 / 3e-05 disease resistance protein (TIR-NBS-LRR class) (.1) AT1G27180 43 / 3e-05 disease resistance protein (TIR-NBS-LRR class), putative (.1) AT1G66830 43 / 4e-05 Leucine-rich repeat protein kinase family protein (.1) AT5G63930 42 / 6e-05 Leucine-rich repeat protein kinase family protein (.1) AT3G28040 41 / 0.0002 Leucine-rich receptor-like protein kinase family protein (.1) AT1G71400 41 / 0.0002 AtRLP12 receptor like protein 12 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022792 [exp] 285 / 3e-91 AT3G14470 343 / 7e-102 NB-ARC domain-containing disease resistance protein (.1) Lus10004127 [exp] 127 / 2e-34 AT3G14470 350 / 5e-105 NB-ARC domain-containing disease resistance protein (.1) Lus10004126 [exp] 127 / 2e-34 AT3G14470 353 / 6e-106 NB-ARC domain-containing disease resistance protein (.1) Lus10029705 [exp] 114 / 3e-31 AT3G14460 112 / 5e-27 LRR and NB-ARC domains-containing disease resistance protein (.1) Lus10022900 [exp] 108 / 6e-28 AT3G14470 350 / 2e-104 NB-ARC domain-containing disease resistance protein (.1) Lus10002609 [exp] 107 / 2e-27 AT3G14470 364 / 9e-110 NB-ARC domain-containing disease resistance protein (.1) Lus10003571 [exp] 86 / 6e-20 AT3G14470 363 / 6e-110 NB-ARC domain-containing disease resistance protein (.1) Lus10039540 [exp] 58 / 3e-10 AT3G14470 727 / 0.0 NB-ARC domain-containing disease resistance protein (.1) Lus10022351 [exp] 53 / 2e-08 AT3G14470 369 / 1e-108 NB-ARC domain-containing disease resistance protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G275800 [exp] 62 / 1e-11 AT3G14470 345 / 3e-100 NB-ARC domain-containing disease resistance protein (.1) Potri.006G273900 [exp] 61 / 3e-11 AT3G14470 364 / 1e-108 NB-ARC domain-containing disease resistance protein (.1) Potri.012G123400 [exp] 60 / 5e-11 AT3G14470 376 / 2e-115 NB-ARC domain-containing disease resistance protein (.1) Potri.012G121876 [exp] 59 / 8e-11 AT3G14470 404 / 6e-125 NB-ARC domain-containing disease resistance protein (.1) Potri.006G271800 [exp] 57 / 4e-10 AT3G14470 345 / 7e-102 NB-ARC domain-containing disease resistance protein (.1) Potri.012G122900 [exp] 57 / 4e-10 AT3G14470 414 / 6e-129 NB-ARC domain-containing disease resistance protein (.1) Potri.006G272066 [exp] 57 / 5e-10 AT3G14470 299 / 2e-85 NB-ARC domain-containing disease resistance protein (.1) Potri.012G122200 [exp] 57 / 7e-10 AT3G14470 411 / 2e-127 NB-ARC domain-containing disease resistance protein (.1) Potri.004G196100 [exp] 57 / 8e-10 AT3G14470 647 / 0.0 NB-ARC domain-containing disease resistance protein (.1) Potri.012G123500 [exp] 56 / 9e-10 AT3G14470 395 / 4e-121 NB-ARC domain-containing disease resistance protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0022 [flax] [poplar] LRR PF00560 [flax] [poplar] LRR_1 Leucine Rich Repeat
Representative CDS sequence Show only first row Show all	>Lus10011855 pacid=23169207 polypeptide=Lus10011855 locus=Lus10011855.g ID=Lus10011855.BGIv1.0 annot-version=v1.0 ATGAATGAAGACGGGACCACTACTCCTTCTACCGCCAGTATCGACGGTAGTAGTGTGGTCCGCAATTTGATGATCCAGTCCCATCACTGGAGGTCTCGTC CAATCAAAGGTTCCCTATTCTCTTCTACAGCGGGTTTACGCAGTTTCATGGCGTCAAGTGGTCTATACACGATCGAACCCAGCGCATACGATCATTCGCG ACGCCTAAGGTCATTGGCTCTCTGCAAATGCTTCCTCAGGGAAATTCCACCAACAATAAACCAGCTTATCCATCTGAGGCTTTTGGATTTGCGCGGGAAC GAATTGCAAGAGTTGCCTGACGAAATATGCGAGCTTTACAATCTATGGGCACTCATCCTGAACGGGAATAGTATGCTGAAGAAGGTACCGGTTGAAATCG GTAAGAAGCTAGTCAACCTAACACATTTCGAAAGTGCGGATGCCCAGCTCTCCTTCCGAAATCAATCGCGAGATTAG
AA sequence Show only first row Show all	>Lus10011855 pacid=23169207 polypeptide=Lus10011855 locus=Lus10011855.g ID=Lus10011855.BGIv1.0 annot-version=v1.0 MNEDGTTTPSTASIDGSSVVRNLMIQSHHWRSRPIKGSLFSSTAGLRSFMASSGLYTIEPSAYDHSRRLRSLALCKCFLREIPPTINQLIHLRLLDLRGN ELQELPDEICELYNLWALILNGNSMLKKVPVEIGKKLVNLTHFESADAQLSFRNQSRD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G14470			NB-ARC domain-containing disea...		Lus10011855 [exp]	0	1
AT1G60170		EMB1220	embryo defective 1220, pre-mRN...		Lus10002830 [exp]	7.6	0.7366
AT5G25610		ATRD22, RD22	RESPONSIVE TO DESSICATION 22, ...		Lus10006555 [exp]	10.6	0.7397
					Lus10009425 [exp]	14.7	0.6882
AT4G18690			unknown protein		Lus10025399 [exp]	18.7	0.7156
AT3G13400		SKS13	SKU5 similar 13 (.1)		Lus10010358 [exp]	20.5	0.7274
AT4G39250	MYB	RSM2, ATRL1	RADIALIS-LIKE SANT/MYB 2, RAD-...		Lus10023568 [exp]	22.2	0.7305
AT1G66370	MYB	ATMYB113	myb domain protein 113 (.1)		Lus10028513 [exp]	25.0	0.7017
AT3G07360		ATPUB9	ARABIDOPSIS THALIANA PLANT U-B...		Lus10024776 [exp]	33.6	0.7082
AT1G50270			Pentatricopeptide repeat (PPR)...		Lus10017351 [exp]	39.2	0.6856
AT4G30200		VEL1, VIL2	VIN3-Like 2, vernalization5/VI...		Lus10040339 [exp]	52.0	0.6640

Compare expression of checked genes

Lus10011855 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.