Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G58430 89 / 6e-22 ATEXO70B1 exocyst subunit exo70 family protein B1 (.1) AT1G07000 41 / 3e-05 ATEXO70B2 exocyst subunit exo70 family protein B2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022795 [exp] 110 / 1e-29 AT5G58430 796 / 0.0 exocyst subunit exo70 family protein B1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G152900 [exp] 94 / 7e-24 AT5G58430 781 / 0.0 exocyst subunit exo70 family protein B1 (.1) Potri.019G124000 [exp] 90 / 2e-22 AT5G58430 726 / 0.0 exocyst subunit exo70 family protein B1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10011859 pacid=23169246 polypeptide=Lus10011859 locus=Lus10011859.g ID=Lus10011859.BGIv1.0 annot-version=v1.0 ATGGCTGACAACGGCGAGGAGAAGGTCATAGCCATGGCCCGCCACATCGCCAAGACCTTAGGCCACAACGAGTCCATGGCAGACGACATCCTCCAGATCT TCTCCAACTTCGACAACCGCTTCTCCCGTGACAAGCTATCCGACCAGATCGCCGCCGCCGCCGCAGGCGGCGGCTGCGGGGCTGACGGTAGAGCTCTCGA ACATGCTCTCACATCACTCGCCCGCCCGATCTCTCAGTCAGATCTCTCAGTACGTCGTCTCCGAGCAACCCATCTGGTCGGATTTGGCTGA
AA sequence Show only first row Show all	>Lus10011859 pacid=23169246 polypeptide=Lus10011859 locus=Lus10011859.g ID=Lus10011859.BGIv1.0 annot-version=v1.0 MADNGEEKVIAMARHIAKTLGHNESMADDILQIFSNFDNRFSRDKLSDQIAAAAAGGGCGADGRALEHALTSLARPISQSDLSVRRLRATHLVGFG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G58430		ATEXO70B1	exocyst subunit exo70 family p...		Lus10011859 [exp]	0	1
AT5G58430		ATEXO70B1	exocyst subunit exo70 family p...		Lus10011860 [exp]	1.7	0.7668
AT2G27500			Glycosyl hydrolase superfamily...		Lus10020618 [exp]	6.0	0.7261
AT4G18950			Integrin-linked protein kinase...		Lus10002765 [exp]	6.7	0.7105
AT3G03050		RHD7, ATCSLD3, ...	ROOT HAIR DEFECTIVE 7, KOJAK, ...		Lus10030454 [exp]	10.0	0.7495
AT5G46910			Transcription factor jumonji (...		Lus10030988 [exp]	10.2	0.6881
AT3G04590	AT-hook		AT hook motif DNA-binding fami...		Lus10006572 [exp]	11.7	0.7394
AT5G57685		LSB1, ATGDU3	LESS SUSCEPTIBLE TO BSCTV 1, A...		Lus10019985 [exp]	14.1	0.7109
AT5G15240			Transmembrane amino acid trans...		Lus10012824 [exp]	14.2	0.7163
					Lus10002746 [exp]	20.0	0.7038
AT5G24430			Calcium-dependent protein kina...		Lus10023234 [exp]	21.5	0.6160

Compare expression of checked genes

Lus10011859 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.