Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G12960 89 / 5e-25 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10011871 pacid=23169217 polypeptide=Lus10011871 locus=Lus10011871.g ID=Lus10011871.BGIv1.0 annot-version=v1.0 ATGGCTGCTGCTAAAGAGAAGTCAGAAATCAAGTACGCGACCGCGCAGGCGAAGCTGTCGGAAGACGAGGCGCTGCGGATCAGGTACAAGCACGGCACCC CTCTTGAAGGCGGCAAGATCGCTGATTCCGAGCCCGTCGATTTGTTCTCCGCCGCTAGTAACGTCGAGGCGGCTAATAAACATCATGATCATCATGTTCA GGGGAAAGATCGTGACCAACCTGATCAGAAAGCGGCAGAGGATAAAGCTACCGATCTCCCCACTGGAGCCGCATGA
AA sequence Show only first row Show all	>Lus10011871 pacid=23169217 polypeptide=Lus10011871 locus=Lus10011871.g ID=Lus10011871.BGIv1.0 annot-version=v1.0 MAAAKEKSEIKYATAQAKLSEDEALRIRYKHGTPLEGGKIADSEPVDLFSAASNVEAANKHHDHHVQGKDRDQPDQKAAEDKATDLPTGAA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G12960			unknown protein		Lus10011871 [exp]	0	1
AT2G41480			Peroxidase superfamily protein...		Lus10020421 [exp]	15.2	0.7756
AT1G33590			Leucine-rich repeat (LRR) fami...		Lus10002936 [exp]	24.9	0.7754
AT1G80450			VQ motif-containing protein (....		Lus10020092 [exp]	30.5	0.6632
AT2G18680			unknown protein		Lus10015508 [exp]	80.1	0.7169
AT2G35270	AT-hook	GIK, 2-ATH, AHL...	GIANT KILLER, Predicted AT-hoo...		Lus10000519 [exp]	81.5	0.7214
AT1G30720			FAD-binding Berberine family p...		Lus10009639 [exp]	90.1	0.6898
AT3G01280		VDAC1, ATVDAC1	ARABIDOPSIS THALIANA VOLTAGE D...		Lus10033098 [exp]	108.8	0.6576
AT4G17260			Lactate/malate dehydrogenase f...		Lus10002983 [exp]	111.9	0.6851
					Lus10029831 [exp]	115.6	0.6974
AT4G37710			VQ motif-containing protein (....		Lus10019270 [exp]	148.8	0.6575

Compare expression of checked genes

Lus10011871 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.