Lus10011878 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G24730 229 / 2e-78 mRNA splicing factor, thioredoxin-like U5 snRNP (.1)
AT5G08290 86 / 6e-22 YLS8 YELLOW-LEAF-SPECIFIC GENE 8, mRNA splicing factor, thioredoxin-like U5 snRNP (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022811 266 / 5e-93 AT3G24730 261 / 7e-91 mRNA splicing factor, thioredoxin-like U5 snRNP (.1)
Lus10017390 86 / 8e-22 AT5G08290 290 / 1e-102 YELLOW-LEAF-SPECIFIC GENE 8, mRNA splicing factor, thioredoxin-like U5 snRNP (.1)
Lus10010188 84 / 2e-21 AT5G08290 293 / 4e-104 YELLOW-LEAF-SPECIFIC GENE 8, mRNA splicing factor, thioredoxin-like U5 snRNP (.1)
Lus10010189 39 / 0.0003 AT5G08290 87 / 4e-23 YELLOW-LEAF-SPECIFIC GENE 8, mRNA splicing factor, thioredoxin-like U5 snRNP (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G287600 227 / 9e-78 AT3G24730 245 / 8e-85 mRNA splicing factor, thioredoxin-like U5 snRNP (.1)
Potri.007G072700 87 / 2e-22 AT5G08290 293 / 5e-104 YELLOW-LEAF-SPECIFIC GENE 8, mRNA splicing factor, thioredoxin-like U5 snRNP (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF02966 DIM1 Mitosis protein DIM1
Representative CDS sequence
>Lus10011878 pacid=23169201 polypeptide=Lus10011878 locus=Lus10011878.g ID=Lus10011878.BGIv1.0 annot-version=v1.0
ATGAGCTATCTTCTGCCGAATCTAACGAAGAAGAAGGAAATCGATTCAATAATCAGGGACACCATCGACAAGGTGCTCGTCCTCCGCTTCGGCCGCGCTT
CCGACGCCACCTGTCTCCAGCTCGACGATATCCTGTCGAAATCGGCGAGGGAGGTCTCCAAGTTCGCGTCGGTGGCAGTCGTGGACATGGATTCCGACGA
TGTGCAGGTCTACGTCAAGTACTTCGTCATCTCTCTGGTTCCTTCCACTGTCTTCTTCTTCAACGCTCACCATATGAAGATGGATTCCGGGACTGCTGAT
CATACCAAATGGATTGGTGCATTTCACACTAAGCAGGACTTCATTGACGTCGTTGAGGCCATATTCAGAGGAGCCATGAAAGGCAAGCTGATAGTGAGTT
GCCCCTTGCCCCCTGATCGAATACCCAAGTATCAGCTGTTTTACAAAGAAGTCTAG
AA sequence
>Lus10011878 pacid=23169201 polypeptide=Lus10011878 locus=Lus10011878.g ID=Lus10011878.BGIv1.0 annot-version=v1.0
MSYLLPNLTKKKEIDSIIRDTIDKVLVLRFGRASDATCLQLDDILSKSAREVSKFASVAVVDMDSDDVQVYVKYFVISLVPSTVFFFNAHHMKMDSGTAD
HTKWIGAFHTKQDFIDVVEAIFRGAMKGKLIVSCPLPPDRIPKYQLFYKEV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G24730 mRNA splicing factor, thioredo... Lus10011878 0 1
AT5G03150 C2H2ZnF JKD JACKDAW, C2H2-like zinc finger... Lus10019927 6.2 0.6650
AT3G02120 hydroxyproline-rich glycoprote... Lus10015381 15.4 0.6895
AT4G30820 cyclin-dependent kinase-activa... Lus10022901 16.7 0.6601
AT2G28105 unknown protein Lus10016142 18.9 0.6254
AT5G39210 CRR7 chlororespiratory reduction 7 ... Lus10032982 21.5 0.6790
AT5G01750 Protein of unknown function (D... Lus10020780 26.5 0.5814
AT5G44120 ATCRA1, CRU1, C... CRUCIFERINA, RmlC-like cupins ... Lus10024889 31.7 0.6555
AT1G60200 splicing factor PWI domain-con... Lus10013003 34.0 0.6539
AT3G07930 DNA glycosylase superfamily pr... Lus10001994 37.3 0.6369
AT1G75340 C3HZnF Zinc finger C-x8-C-x5-C-x3-H t... Lus10040585 39.2 0.6257

Lus10011878 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.