Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF07172 [flax] [poplar] GRP Glycine rich protein family
Representative CDS sequence Show only first row Show all	>Lus10011890 pacid=23169199 polypeptide=Lus10011890 locus=Lus10011890.g ID=Lus10011890.BGIv1.0 annot-version=v1.0 ATGACGACCAATAACAAGCTTATTTCAGTCACCCTTTTCATTGCCCTCGTCGCCCTATTCTCCATTGATCGAAATGCAGCCCATGCAGCTCGTGACGTAC CCACCACCACCAAGGCGGCTACCCCGTCCGCCGCCGGCCTTACTGACCAAAAGAACTTCGTCTCTTTCGGCGGCGTAGGTGGGTTCGCTGGAGTCGGAGG CGCAGGCGCTGGCGGTGGAATCGGAGGGCTTGGTGGTGGTGGTCTCGGAGGCCTTAGTTTTACGTACGGAATTGAAAACACTGTATTCCGGTACAAAAGA AAAGTAACCTTAATTATTGAATTGAGTGTAGATAATGAAGGGGAGTAA
AA sequence Show only first row Show all	>Lus10011890 pacid=23169199 polypeptide=Lus10011890 locus=Lus10011890.g ID=Lus10011890.BGIv1.0 annot-version=v1.0 MTTNNKLISVTLFIALVALFSIDRNAAHAARDVPTTTKAATPSAAGLTDQKNFVSFGGVGGFAGVGGAGAGGGIGGLGGGGLGGLSFTYGIENTVFRYKR KVTLIIELSVDNEGE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10011890 [exp]	0	1
AT2G24800			Peroxidase superfamily protein...		Lus10026903 [exp]	1.0	0.9321
AT1G07080			Thioredoxin superfamily protei...		Lus10022669 [exp]	2.4	0.9148
AT1G73530			RNA-binding (RRM/RBD/RNP motif...		Lus10042293 [exp]	3.0	0.9141
AT4G19420			Pectinacetylesterase family pr...		Lus10034766 [exp]	3.7	0.8998
					Lus10022823 [exp]	3.9	0.9093
AT4G12910		SCPL20	serine carboxypeptidase-like 2...		Lus10009562 [exp]	7.3	0.9092
AT1G09795		HISN1B, ATATP-P...	ATP phosphoribosyl transferase...		Lus10028993 [exp]	9.5	0.8715
AT5G16030			unknown protein		Lus10033537 [exp]	11.6	0.8854
AT5G15310	MYB	ATMYB16, ATMIXT...	myb domain protein 16 (.1.2)		Lus10015376 [exp]	11.7	0.8975
AT1G05230	HD	HDG2	homeodomain GLABROUS 2 (.1.2.3...		Lus10039667 [exp]	14.3	0.8824

Compare expression of checked genes

Lus10011890 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.