Lus10011892 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G16295 70 / 9e-16 SPH1 S-protein homologue 1 (.1)
AT4G29035 68 / 4e-15 Plant self-incompatibility protein S1 family (.1)
AT5G04347 66 / 3e-14 Plant self-incompatibility protein S1 family (.1)
AT2G06090 62 / 4e-13 Plant self-incompatibility protein S1 family (.1)
AT5G04350 59 / 2e-11 Plant self-incompatibility protein S1 family (.1)
AT3G26880 57 / 9e-11 Plant self-incompatibility protein S1 family (.1)
AT3G26870 56 / 1e-10 Plant self-incompatibility protein S1 family (.1)
AT5G06020 52 / 5e-09 Plant self-incompatibility protein S1 family (.1)
AT5G06030 50 / 2e-08 Plant self-incompatibility protein S1 family (.1)
AT5G12060 50 / 4e-08 Plant self-incompatibility protein S1 family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022824 216 / 3e-73 AT5G04347 67 / 9e-15 Plant self-incompatibility protein S1 family (.1)
Lus10022826 209 / 3e-70 AT4G29035 68 / 5e-15 Plant self-incompatibility protein S1 family (.1)
Lus10022825 125 / 2e-37 AT4G29035 43 / 7e-06 Plant self-incompatibility protein S1 family (.1)
Lus10011895 104 / 8e-29 AT4G29035 72 / 3e-16 Plant self-incompatibility protein S1 family (.1)
Lus10011897 97 / 3e-26 AT2G06090 73 / 2e-17 Plant self-incompatibility protein S1 family (.1)
Lus10014630 92 / 1e-24 AT5G38435 57 / 1e-11 S-protein homologue 8 (.1)
Lus10029390 89 / 3e-23 AT4G16295 71 / 5e-16 S-protein homologue 1 (.1)
Lus10042506 88 / 2e-22 AT4G16295 112 / 5e-32 S-protein homologue 1 (.1)
Lus10016350 86 / 4e-22 AT2G06090 59 / 1e-11 Plant self-incompatibility protein S1 family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G066900 107 / 3e-30 AT4G29035 85 / 1e-21 Plant self-incompatibility protein S1 family (.1)
Potri.002G252500 80 / 1e-19 AT4G16295 116 / 9e-34 S-protein homologue 1 (.1)
Potri.004G199700 73 / 9e-17 AT4G16295 69 / 2e-15 S-protein homologue 1 (.1)
Potri.004G199801 70 / 1e-15 AT4G16295 67 / 2e-14 S-protein homologue 1 (.1)
Potri.010G008300 64 / 2e-13 AT3G17080 74 / 8e-18 Plant self-incompatibility protein S1 family (.1)
Potri.003G201300 51 / 1e-08 AT2G06090 65 / 5e-14 Plant self-incompatibility protein S1 family (.1)
Potri.018G148366 50 / 2e-08 AT1G04645 103 / 1e-29 Plant self-incompatibility protein S1 family (.1)
Potri.018G148630 49 / 1e-07 AT1G04645 106 / 3e-30 Plant self-incompatibility protein S1 family (.1)
Potri.003G175200 48 / 2e-07 AT3G24060 177 / 2e-58 Plant self-incompatibility protein S1 family (.1)
Potri.006G170200 47 / 6e-07 AT5G12060 48 / 1e-07 Plant self-incompatibility protein S1 family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05938 Self-incomp_S1 Plant self-incompatibility protein S1
Representative CDS sequence
>Lus10011892 pacid=23169260 polypeptide=Lus10011892 locus=Lus10011892.g ID=Lus10011892.BGIv1.0 annot-version=v1.0
ATGACTGCAACCTCCGTCGTCGTCCTTGCAATATTAGCACTGTCATCCGCCGGCGCTATAACTTCCTCCGCCGCCGGTTACACCCCGTTCCCCGTCCACC
ACGTCCACGTCACCAGCCAACTGACCCGCGGGAAGGTGCTGTTGGTACATTGTCAGTCCAAGGACGATGACCTCGGGGTCCACAACCTGACCAGCGGTGG
CGAATTCAAGTGGCAGTTCAAGCTGAACCTCCTAGGGCACACGCTGTTCTGGTGCTACCTGGCCCCCGACCGTTCGCATCACATCGCGTACGATGCGTTT
AAGGAGGAGGACGCCAACTACCAGGAGTACTATTTTCATACGTATTGGATTGCGAAAGACGACGGGGTTTATTTGAGACGGGTGCGGGAGAAGGTCGACC
AGCGTTATTTCGGATGGGAAAACGGGAGGGGTTTGTTGATGAACCATACTCGAGATATATGA
AA sequence
>Lus10011892 pacid=23169260 polypeptide=Lus10011892 locus=Lus10011892.g ID=Lus10011892.BGIv1.0 annot-version=v1.0
MTATSVVVLAILALSSAGAITSSAAGYTPFPVHHVHVTSQLTRGKVLLVHCQSKDDDLGVHNLTSGGEFKWQFKLNLLGHTLFWCYLAPDRSHHIAYDAF
KEEDANYQEYYFHTYWIAKDDGVYLRRVREKVDQRYFGWENGRGLLMNHTRDI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G16295 SPH1 S-protein homologue 1 (.1) Lus10011892 0 1
AT4G16295 SPH1 S-protein homologue 1 (.1) Lus10000558 2.2 1.0000
AT3G51590 LTP12 lipid transfer protein 12 (.1) Lus10004067 3.2 1.0000
AT1G17930 Aminotransferase-like, plant m... Lus10005482 3.9 1.0000
Lus10011636 4.5 1.0000
AT3G16970 Plant self-incompatibility pro... Lus10011753 5.0 1.0000
AT3G18990 B3 REM39, VRN1 REDUCED VERNALIZATION RESPONSE... Lus10022473 6.0 1.0000
AT4G10950 SGNH hydrolase-type esterase s... Lus10023070 6.5 1.0000
AT1G34575 FAD-binding Berberine family p... Lus10023373 6.9 1.0000
AT2G02340 ATPP2-B8 phloem protein 2-B8 (.1) Lus10025662 7.3 1.0000
AT4G27570 UDP-Glycosyltransferase superf... Lus10013368 7.7 1.0000

Lus10011892 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.