Lus10011895 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G29035 71 / 9e-16 Plant self-incompatibility protein S1 family (.1)
AT4G16295 69 / 3e-15 SPH1 S-protein homologue 1 (.1)
AT3G16970 56 / 2e-10 Plant self-incompatibility protein S1 family (.1)
AT2G06090 55 / 5e-10 Plant self-incompatibility protein S1 family (.1)
AT5G04047 54 / 9e-10 Plant self-incompatibility protein S1 family (.1)
AT4G24975 54 / 2e-09 Plant self-incompatibility protein S1 family (.1)
AT5G12070 52 / 8e-09 Plant self-incompatibility protein S1 family (.1)
AT3G17080 50 / 2e-08 Plant self-incompatibility protein S1 family (.1)
AT5G38435 50 / 2e-08 SPH8 S-protein homologue 8 (.1)
AT4G24974 50 / 3e-08 Plant self-incompatibility protein S1 family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011892 107 / 5e-30 AT4G16295 71 / 3e-16 S-protein homologue 1 (.1)
Lus10011897 103 / 1e-28 AT2G06090 73 / 2e-17 Plant self-incompatibility protein S1 family (.1)
Lus10022826 103 / 2e-28 AT4G29035 68 / 5e-15 Plant self-incompatibility protein S1 family (.1)
Lus10022824 102 / 3e-28 AT5G04347 67 / 9e-15 Plant self-incompatibility protein S1 family (.1)
Lus10016171 102 / 3e-28 AT5G04347 54 / 7e-10 Plant self-incompatibility protein S1 family (.1)
Lus10016350 83 / 1e-20 AT2G06090 59 / 1e-11 Plant self-incompatibility protein S1 family (.1)
Lus10029390 81 / 1e-19 AT4G16295 71 / 5e-16 S-protein homologue 1 (.1)
Lus10022830 80 / 2e-19 AT2G06090 67 / 6e-15 Plant self-incompatibility protein S1 family (.1)
Lus10014630 77 / 1e-18 AT5G38435 57 / 1e-11 S-protein homologue 8 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G066900 92 / 4e-24 AT4G29035 85 / 1e-21 Plant self-incompatibility protein S1 family (.1)
Potri.002G252500 80 / 3e-19 AT4G16295 116 / 9e-34 S-protein homologue 1 (.1)
Potri.010G008300 71 / 5e-16 AT3G17080 74 / 8e-18 Plant self-incompatibility protein S1 family (.1)
Potri.004G199700 63 / 7e-13 AT4G16295 69 / 2e-15 S-protein homologue 1 (.1)
Potri.006G170200 56 / 4e-10 AT5G12060 48 / 1e-07 Plant self-incompatibility protein S1 family (.1)
Potri.018G148366 52 / 5e-09 AT1G04645 103 / 1e-29 Plant self-incompatibility protein S1 family (.1)
Potri.003G201300 51 / 1e-08 AT2G06090 65 / 5e-14 Plant self-incompatibility protein S1 family (.1)
Potri.018G148630 51 / 2e-08 AT1G04645 106 / 3e-30 Plant self-incompatibility protein S1 family (.1)
Potri.004G199801 49 / 1e-07 AT4G16295 67 / 2e-14 S-protein homologue 1 (.1)
Potri.001G053300 45 / 3e-06 AT3G24060 82 / 2e-20 Plant self-incompatibility protein S1 family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05938 Self-incomp_S1 Plant self-incompatibility protein S1
Representative CDS sequence
>Lus10011895 pacid=23169219 polypeptide=Lus10011895 locus=Lus10011895.g ID=Lus10011895.BGIv1.0 annot-version=v1.0
ATGGAATCAGCATCACAGCTCATCCTCACCACCACCGCCCTAGCAACAATACTCATACTACTCTCGCCATCGTCCGGTGCCGGCGGAAGACCATCCGATG
AGGCCGAACCTTCAACTCCCCCGCCGGCGAAAGGACAAGGCATCATATTATCCTACATACACGTACACGTGACCAACGATCTCGGTCCAGATCAGTCGCT
GACGGTGCACTGCCAGTCCAAAGATGACGACCTCGGGAGCCACAACCTCGACAACGGGAGCGAGTTCACGTGGCGGTTCAGGCCGAGGATTGCGTTCGGC
GAAACGCTGTTCTGGTGCTACGTGGCACCCGTCAGCGAGGAGCTCCATGTACGTTTCGATGCTTACGTGTACAACGACCCTAGCTTTATCCAGTATAAGC
ACAACATCTACTGGGAGGTCAGACCTGACGGCGTTTACATGAGGAATCCGGCTCGTGGGAAAGAAGAGTTTAGGCATAAATGGTCCTCTGGAAGAATTGC
TGTGTAA
AA sequence
>Lus10011895 pacid=23169219 polypeptide=Lus10011895 locus=Lus10011895.g ID=Lus10011895.BGIv1.0 annot-version=v1.0
MESASQLILTTTALATILILLSPSSGAGGRPSDEAEPSTPPPAKGQGIILSYIHVHVTNDLGPDQSLTVHCQSKDDDLGSHNLDNGSEFTWRFRPRIAFG
ETLFWCYVAPVSEELHVRFDAYVYNDPSFIQYKHNIYWEVRPDGVYMRNPARGKEEFRHKWSSGRIAV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G29035 Plant self-incompatibility pro... Lus10011895 0 1
AT5G17600 RING/U-box superfamily protein... Lus10008458 3.3 0.9837
AT5G02930 F-box/RNI-like superfamily pro... Lus10040452 4.4 0.8957
AT5G12060 Plant self-incompatibility pro... Lus10023195 4.7 0.9837
AT3G50930 BCS1 cytochrome BC1 synthesis (.1) Lus10037004 5.1 0.8346
AT4G10850 SWEET7, AtSWEET... Nodulin MtN3 family protein (.... Lus10023047 5.7 0.9837
AT4G35610 C2H2ZnF zinc finger (C2H2 type) family... Lus10035994 6.6 0.9822
AT5G07480 KUOX1 KAR-UP oxidoreductase 1 (.1) Lus10043000 7.4 0.9821
AT1G70780 unknown protein Lus10009131 7.7 0.8291
AT4G05130 ATENT4 equilibrative nucleoside trans... Lus10002590 8.0 0.9319
AT3G08710 TRXH9, ATH9 THIOREDOXIN TYPE H 9, thioredo... Lus10030505 8.1 0.9813

Lus10011895 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.