Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G06090 62 / 5e-13 Plant self-incompatibility protein S1 family (.1) AT5G12060 57 / 3e-11 Plant self-incompatibility protein S1 family (.1) AT4G16295 57 / 3e-11 SPH1 S-protein homologue 1 (.1) AT1G04645 57 / 3e-11 Plant self-incompatibility protein S1 family (.1) AT4G29035 57 / 6e-11 Plant self-incompatibility protein S1 family (.1) AT5G27238 53 / 8e-10 Plant self-incompatibility protein S1 family (.1) AT5G12070 52 / 4e-09 Plant self-incompatibility protein S1 family (.1) AT3G17080 49 / 5e-08 Plant self-incompatibility protein S1 family (.1) AT3G26880 49 / 5e-08 Plant self-incompatibility protein S1 family (.1) AT1G26798 47 / 2e-07 Plant self-incompatibility protein S1 family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022830 [exp] 168 / 1e-54 AT2G06090 67 / 6e-15 Plant self-incompatibility protein S1 family (.1) Lus10022829 [exp] 129 / 8e-40 AT5G12060 46 / 2e-07 Plant self-incompatibility protein S1 family (.1) Lus10011897 [exp] 126 / 2e-38 AT2G06090 73 / 2e-17 Plant self-incompatibility protein S1 family (.1) Lus10021633 [exp] 92 / 7e-25 AT4G29035 57 / 4e-11 Plant self-incompatibility protein S1 family (.1) Lus10000683 [exp] 92 / 2e-24 AT4G16295 57 / 5e-11 S-protein homologue 1 (.1) Lus10000682 [exp] 88 / 9e-23 AT4G16295 56 / 4e-10 S-protein homologue 1 (.1) Lus10021634 [exp] 84 / 2e-21 AT4G29035 58 / 4e-11 Plant self-incompatibility protein S1 family (.1) Lus10016350 [exp] 84 / 2e-21 AT2G06090 59 / 1e-11 Plant self-incompatibility protein S1 family (.1) Lus10000558 [exp] 82 / 4e-21 AT4G16295 55 / 1e-10 S-protein homologue 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G252500 [exp] 71 / 2e-16 AT4G16295 116 / 9e-34 S-protein homologue 1 (.1) Potri.016G066900 [exp] 62 / 6e-13 AT4G29035 85 / 1e-21 Plant self-incompatibility protein S1 family (.1) Potri.004G199700 [exp] 61 / 2e-12 AT4G16295 69 / 2e-15 S-protein homologue 1 (.1) Potri.001G053300 [exp] 50 / 2e-08 AT3G24060 82 / 2e-20 Plant self-incompatibility protein S1 family (.1) Potri.018G148630 [exp] 50 / 2e-08 AT1G04645 106 / 3e-30 Plant self-incompatibility protein S1 family (.1) Potri.004G199801 [exp] 50 / 3e-08 AT4G16295 67 / 2e-14 S-protein homologue 1 (.1) Potri.003G201300 [exp] 47 / 2e-07 AT2G06090 65 / 5e-14 Plant self-incompatibility protein S1 family (.1) Potri.010G008300 [exp] 43 / 7e-06 AT3G17080 74 / 8e-18 Plant self-incompatibility protein S1 family (.1) Potri.003G175200 [exp] 42 / 1e-05 AT3G24060 177 / 2e-58 Plant self-incompatibility protein S1 family (.1) Potri.018G148366 [exp] 38 / 0.0003 AT1G04645 103 / 1e-29 Plant self-incompatibility protein S1 family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05938 [flax] [poplar] Self-incomp_S1 Plant self-incompatibility protein S1
Representative CDS sequence Show only first row Show all	>Lus10011896 pacid=23169235 polypeptide=Lus10011896 locus=Lus10011896.g ID=Lus10011896.BGIv1.0 annot-version=v1.0 ATGAAGTCGCCAGCGTCATCGGCCGCCGCTGCCGCCGTACTTGTGGTGGCGACAGTACTGTTGCTTTCCACCCGAGCCTCCGGCATCGGCTTAGGCCCGT TGTGGACGTACATGCATGTGCACATTATGAACGAGTTCGACAGACACCACTACCCGCTGATGGTACACTGCAAGTCTAAGAACGACGACATGGGGATCCA CTGGGTCGGCCCGCATGGGGAGTACGCGTGGAGGTTCAAGCCCACGATCACCGACGAGACTTTGTTCTGGTGCCACGTGTCGAAACACGGCAAAGAAATT GTCTACGACGCTTACTGGGAGGACGGCAAGGACTACGAGAGGATGCACCTGGACCACATACGTTGGGTGGCGAAAGACGACGGCATTTATTAG
AA sequence Show only first row Show all	>Lus10011896 pacid=23169235 polypeptide=Lus10011896 locus=Lus10011896.g ID=Lus10011896.BGIv1.0 annot-version=v1.0 MKSPASSAAAAAVLVVATVLLLSTRASGIGLGPLWTYMHVHIMNEFDRHHYPLMVHCKSKNDDMGIHWVGPHGEYAWRFKPTITDETLFWCHVSKHGKEI VYDAYWEDGKDYERMHLDHIRWVAKDDGIY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G06090			Plant self-incompatibility pro...		Lus10011896 [exp]	0	1
					Lus10005297 [exp]	1.4	1.0000
AT5G53910			RING/U-box superfamily protein...		Lus10011380 [exp]	2.0	1.0000
					Lus10013260 [exp]	2.4	1.0000
AT1G17930			Aminotransferase-like, plant m...		Lus10011644 [exp]	3.3	0.9790
AT4G22880		TT18, TDS4, ANS...	TANNIN DEFICIENT SEED 4, ANTHO...		Lus10006709 [exp]	4.8	0.8519
AT3G52490			Double Clp-N motif-containing ...		Lus10024536 [exp]	5.0	1.0000
AT4G10850		SWEET7, AtSWEET...	Nodulin MtN3 family protein (....		Lus10032426 [exp]	5.2	0.9848
AT3G13790		ATCWINV1, ATBFR...	ARABIDOPSIS THALIANA CELL WALL...		Lus10015614 [exp]	5.3	1.0000
AT5G13930		ATCHS, TT4, CHS	TRANSPARENT TESTA 4, CHALCONE ...		Lus10011745 [exp]	6.0	0.9586
					Lus10006529 [exp]	6.5	1.0000

Compare expression of checked genes

Lus10011896 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.