Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021787 [exp] 90 / 2e-25 ND / Lus10030580 [exp] 63 / 9e-15 ND / Lus10030574 [exp] 45 / 7e-08 ND / Lus10030579 [exp] 41 / 5e-06 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G021450 [exp] 35 / 0.0003 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10011908 pacid=23169269 polypeptide=Lus10011908 locus=Lus10011908.g ID=Lus10011908.BGIv1.0 annot-version=v1.0 ATGGATAAGACATCTATAAAATTGATTTACTTAGTTGCGCTCTTGATTTTCGTTGCAGGTGAGACTTCAAACATCGTAGCAGAAGGAAGAGATGTTGACC AATTCGTTCCGTCCCCGTGCTTCTGTACTCCTCCGTGCATTTGCCACGGCTACTGGAAATGTAGTTGCCCCGAAGATTCGACGTTGACTTCCCAGGAGAC AAACGTTGTAGTCAACGAATTAGTCAATTGA
AA sequence Show only first row Show all	>Lus10011908 pacid=23169269 polypeptide=Lus10011908 locus=Lus10011908.g ID=Lus10011908.BGIv1.0 annot-version=v1.0 MDKTSIKLIYLVALLIFVAGETSNIVAEGRDVDQFVPSPCFCTPPCICHGYWKCSCPEDSTLTSQETNVVVNELVN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10011908 [exp]	0	1
					Lus10026438 [exp]	3.0	0.8095
AT1G19250		FMO1	flavin-dependent monooxygenase...		Lus10005178 [exp]	3.2	0.8274
AT3G04620		DAN1	D NUCLDUO1-ACTIVATEEIC ACID BI...		Lus10005531 [exp]	4.2	0.8817
AT1G68530		KCS6, CER6, POP...	POLLEN-PISTIL INCOMPATIBILITY ...		Lus10015195 [exp]	5.3	0.6740
AT4G27300			S-locus lectin protein kinase ...		Lus10037865 [exp]	7.9	0.7322
AT1G47710			Serine protease inhibitor (SER...		Lus10009906 [exp]	8.3	0.7213
AT3G26880			Plant self-incompatibility pro...		Lus10022631 [exp]	10.2	0.7928
AT3G25050		XTH3	xyloglucan endotransglucosylas...		Lus10022782 [exp]	11.4	0.7928
					Lus10023108 [exp]	12.5	0.7928
					Lus10024321 [exp]	13.5	0.7928

Compare expression of checked genes

Lus10011908 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.