Lus10011953 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G12080 273 / 2e-87 ATMSL10, MSL10 mechanosensitive channel of small conductance-like 10 (.1.2.3)
AT5G19520 247 / 1e-77 ATMSL9, MSL9 mechanosensitive channel of small conductance-like 9 (.1)
AT1G53470 171 / 6e-49 MSL4 mechanosensitive channel of small conductance-like 4 (.1)
AT3G14810 160 / 3e-45 MSL5 mechanosensitive channel of small conductance-like 5 (.1.2)
AT2G17010 159 / 7e-45 Mechanosensitive ion channel family protein (.1)
AT2G17000 151 / 5e-42 Mechanosensitive ion channel family protein (.1)
AT1G78610 149 / 2e-41 MSL6 mechanosensitive channel of small conductance-like 6 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027617 402 / 4e-135 AT5G12080 839 / 0.0 mechanosensitive channel of small conductance-like 10 (.1.2.3)
Lus10019694 328 / 1e-108 AT5G12080 778 / 0.0 mechanosensitive channel of small conductance-like 10 (.1.2.3)
Lus10016423 320 / 7e-106 AT5G12080 786 / 0.0 mechanosensitive channel of small conductance-like 10 (.1.2.3)
Lus10002960 226 / 2e-71 AT5G12080 605 / 0.0 mechanosensitive channel of small conductance-like 10 (.1.2.3)
Lus10006347 226 / 2e-69 AT5G12080 659 / 0.0 mechanosensitive channel of small conductance-like 10 (.1.2.3)
Lus10036586 199 / 1e-59 AT5G12080 573 / 0.0 mechanosensitive channel of small conductance-like 10 (.1.2.3)
Lus10036587 198 / 2e-59 AT5G12080 549 / 0.0 mechanosensitive channel of small conductance-like 10 (.1.2.3)
Lus10005556 189 / 5e-57 AT1G53470 758 / 0.0 mechanosensitive channel of small conductance-like 4 (.1)
Lus10013692 175 / 1e-53 AT1G53470 496 / 6e-170 mechanosensitive channel of small conductance-like 4 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G222500 310 / 1e-101 AT5G12080 766 / 0.0 mechanosensitive channel of small conductance-like 10 (.1.2.3)
Potri.006G144100 223 / 3e-68 AT5G12080 611 / 0.0 mechanosensitive channel of small conductance-like 10 (.1.2.3)
Potri.013G073000 203 / 2e-61 AT5G12080 536 / 0.0 mechanosensitive channel of small conductance-like 10 (.1.2.3)
Potri.013G072800 196 / 1e-58 AT5G12080 512 / 2e-172 mechanosensitive channel of small conductance-like 10 (.1.2.3)
Potri.001G384100 163 / 2e-46 AT1G78610 852 / 0.0 mechanosensitive channel of small conductance-like 6 (.1)
Potri.011G105500 162 / 6e-46 AT1G78610 869 / 0.0 mechanosensitive channel of small conductance-like 6 (.1)
Potri.004G178900 148 / 4e-41 AT1G78610 819 / 0.0 mechanosensitive channel of small conductance-like 6 (.1)
Potri.005G246600 133 / 8e-36 AT1G53470 644 / 0.0 mechanosensitive channel of small conductance-like 4 (.1)
PFAM info
Representative CDS sequence
>Lus10011953 pacid=23146512 polypeptide=Lus10011953 locus=Lus10011953.g ID=Lus10011953.BGIv1.0 annot-version=v1.0
ATGGCACAGTTTCACAAAATCAAGCAAGAAAAGGTTTCAGCTTGGACAATGAAAGTTTTGGTGGATGCAGTCACTAAATCCGGGCTCTCGACGATTTCGA
ATTCGTTGGATGAGAGCCGCCATGATGCAGGAGGAGGAAATACAGATCAAGAGATTACTAACGAACTGGATGCAACTGTTGCAGGATTACGCATTTTCAG
AAACGTTGCTCCTCGTCGTTGCAAGTACATTGAGGAAGAGGACTTTTTGAGATTTATGATCAAGGAAGAGGTGGATCTCTTCTTTCCGCTGATTGAAGGT
TCTGAAAGTGGAAAGGTTGACAAAAAAGCCTTCACTGAATGGGTGGTGAAGGTTTACAATGGCCGCACAGCACTTGCACACGCCCTGAACGATACGAAAA
CGGCCGTTAAACAGCTTAACAAATTAGTGACAGGTATTCTAATTCTGGTGACAATTGTTATCTGGCTTCTGCTTATGCAGATCGCTACAACGAAAGTGCT
GGTGTTCCTCTCGTCGCAGCTGGTGTTGGCTGCTTTTATGTTTGGGAACACTTGCAAGAACATATTCGAGGCCATCATATTCGTATTCGTGATGCATCCA
TTTGATGTGGGGGACCGTTGTGTTGTGGATGGCGTCCCAGTAAGTTAG
AA sequence
>Lus10011953 pacid=23146512 polypeptide=Lus10011953 locus=Lus10011953.g ID=Lus10011953.BGIv1.0 annot-version=v1.0
MAQFHKIKQEKVSAWTMKVLVDAVTKSGLSTISNSLDESRHDAGGGNTDQEITNELDATVAGLRIFRNVAPRRCKYIEEEDFLRFMIKEEVDLFFPLIEG
SESGKVDKKAFTEWVVKVYNGRTALAHALNDTKTAVKQLNKLVTGILILVTIVIWLLLMQIATTKVLVFLSSQLVLAAFMFGNTCKNIFEAIIFVFVMHP
FDVGDRCVVDGVPVS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G12080 ATMSL10, MSL10 mechanosensitive channel of sm... Lus10011953 0 1
AT1G54510 ATNEK1 NIMA-related serine/threonine ... Lus10015928 1.7 0.9047
AT2G46330 ATAGP16, AGP16 arabinogalactan protein 16 (.1... Lus10000542 7.3 0.8857
AT5G19520 ATMSL9, MSL9 mechanosensitive channel of sm... Lus10011952 11.2 0.8639
AT5G65260 RNA-binding (RRM/RBD/RNP motif... Lus10009323 15.0 0.8632
AT5G49665 Zinc finger (C3HC4-type RING f... Lus10028223 15.3 0.8657
AT4G24710 P-loop containing nucleoside t... Lus10043321 15.7 0.8728
AT3G52270 Transcription initiation facto... Lus10040084 18.9 0.8469
AT5G52860 ABCG8 ATP-binding cassette G8, ABC-2... Lus10027545 20.1 0.8702
AT3G19820 CBB1, EVE1, DW1... ENHANCED VERY-LOW-FLUENCE RESP... Lus10010215 22.8 0.8480
AT1G10180 unknown protein Lus10018297 25.8 0.8577

Lus10011953 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.