Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G12080 56 / 3e-11 ATMSL10, MSL10 mechanosensitive channel of small conductance-like 10 (.1.2.3) AT5G19520 52 / 1e-09 ATMSL9, MSL9 mechanosensitive channel of small conductance-like 9 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027617 [exp] 113 / 4e-31 AT5G12080 839 / 0.0 mechanosensitive channel of small conductance-like 10 (.1.2.3) Lus10019694 [exp] 92 / 6e-24 AT5G12080 778 / 0.0 mechanosensitive channel of small conductance-like 10 (.1.2.3) Lus10016423 [exp] 92 / 6e-24 AT5G12080 786 / 0.0 mechanosensitive channel of small conductance-like 10 (.1.2.3) Lus10036586 [exp] 59 / 5e-12 AT5G12080 573 / 0.0 mechanosensitive channel of small conductance-like 10 (.1.2.3) Lus10036587 [exp] 59 / 5e-12 AT5G12080 549 / 0.0 mechanosensitive channel of small conductance-like 10 (.1.2.3) Lus10029701 [exp] 58 / 8e-12 AT5G12080 523 / 9e-177 mechanosensitive channel of small conductance-like 10 (.1.2.3) Lus10002960 [exp] 56 / 7e-11 AT5G12080 605 / 0.0 mechanosensitive channel of small conductance-like 10 (.1.2.3) Lus10006347 [exp] 54 / 3e-10 AT5G12080 659 / 0.0 mechanosensitive channel of small conductance-like 10 (.1.2.3) Lus10004153 [exp] 37 / 0.0003 AT2G17700 611 / 0.0 serine/threonine/tyrosine kinase 8, ACT-like protein tyrosine kinase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G222500 [exp] 84 / 6e-21 AT5G12080 766 / 0.0 mechanosensitive channel of small conductance-like 10 (.1.2.3) Potri.006G144100 [exp] 64 / 7e-14 AT5G12080 611 / 0.0 mechanosensitive channel of small conductance-like 10 (.1.2.3) Potri.013G073000 [exp] 61 / 7e-13 AT5G12080 536 / 0.0 mechanosensitive channel of small conductance-like 10 (.1.2.3) Potri.013G072800 [exp] 60 / 2e-12 AT5G12080 512 / 2e-172 mechanosensitive channel of small conductance-like 10 (.1.2.3) Potri.004G178900 [exp] 47 / 8e-08 AT1G78610 819 / 0.0 mechanosensitive channel of small conductance-like 6 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10011954 pacid=23146544 polypeptide=Lus10011954 locus=Lus10011954.g ID=Lus10011954.BGIv1.0 annot-version=v1.0 ATGGCTTTGTATTGTAACCACACGATGAACTTCCAAGAGTATGCAGAGAAGAACAAGAGGAGGACTGAGTTGATGATGGAGATGAAGAACATATTTGAGG AGCTATGCATTGCATACTATCTTCTACCACAGCATGTGCATCTGAAATCTGCTGACGCGCAACCTAAGTGA
AA sequence Show only first row Show all	>Lus10011954 pacid=23146544 polypeptide=Lus10011954 locus=Lus10011954.g ID=Lus10011954.BGIv1.0 annot-version=v1.0 MALYCNHTMNFQEYAEKNKRRTELMMEMKNIFEELCIAYYLLPQHVHLKSADAQPK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G12080		ATMSL10, MSL10	mechanosensitive channel of sm...		Lus10011954 [exp]	0	1
AT2G04630		NRPE6B, NRPB6B	RNA polymerase Rpb6 (.1)		Lus10038878 [exp]	5.1	0.8441
AT1G61700			RNA polymerases N / 8 kDa subu...		Lus10008095 [exp]	6.0	0.8316
AT2G47640			Small nuclear ribonucleoprotei...		Lus10013840 [exp]	7.1	0.8162
AT1G76860			Small nuclear ribonucleoprotei...		Lus10042341 [exp]	9.4	0.8009
AT5G56670			Ribosomal protein S30 family p...		Lus10017473 [exp]	12.2	0.8411
AT2G35736			unknown protein		Lus10028935 [exp]	13.6	0.8278
AT3G54860		ATVPS33	VACUOLAR PROTEIN SORTING 33, S...		Lus10007300 [exp]	14.8	0.7704
AT4G19150			Ankyrin repeat family protein ...		Lus10001048 [exp]	20.5	0.7793
AT3G14080			Small nuclear ribonucleoprotei...		Lus10013161 [exp]	21.6	0.7254
AT1G61700			RNA polymerases N / 8 kDa subu...		Lus10025907 [exp]	24.5	0.7663

Compare expression of checked genes

Lus10011954 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.