Lus10011965 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002600 106 / 6e-28 AT3G14770 62 / 1e-10 Nodulin MtN3 family protein (.1)
Lus10007303 88 / 4e-21 AT3G23950 45 / 6e-05 F-box family protein (.1)
Lus10040838 85 / 9e-20 AT3G23950 57 / 2e-08 F-box family protein (.1)
Lus10003349 84 / 2e-19 AT1G46912 48 / 2e-05 F-box associated ubiquitination effector family protein (.1.2)
Lus10018225 74 / 4e-17 ND /
Lus10013907 77 / 5e-17 ND /
Lus10007302 74 / 5e-16 AT1G15680 49 / 4e-06 F-box family protein (.1)
Lus10004929 72 / 2e-15 ND /
Lus10007301 65 / 5e-13 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10011965 pacid=23161488 polypeptide=Lus10011965 locus=Lus10011965.g ID=Lus10011965.BGIv1.0 annot-version=v1.0
ATGTCTATCACCTTCAGGTGTTCCAGCCAAGGGTTTCCTGCTGGGCTACTCCAATTCCAAGGTATGAGGAATTGCGAGGCATGTATGATGGAAGCTACAG
CTTTTGGGTTCAGAGCAGCAGTGAACATGGATAATGTTAAGAAATCAGCCCTTTGCGATGACTACATGGAACTTGTCTCTGAAGAAGCAACTCTGAAGAT
GGTGGCTGAAATCATTCAACGTAGGAAGAAGAAAATCAGCGAACTTGTTTTAAATGAAAGGGAGCAGCCACAGCATCGTTTTCCTTTTGACAAGGAATTG
GATGTACTAGAAGCTGATTTGAAAGATGTTGAAGCTGAAATTGCCGCCATTGCTAAATCGAAAGAAGAAGTGAAGAGCTTCCTTATCCTACAGCGAGAAA
TCCAAAGAGACCACCTAGAAGTGCGCTCGTGGGTAAAAATTGCAGGCCATCGATGA
AA sequence
>Lus10011965 pacid=23161488 polypeptide=Lus10011965 locus=Lus10011965.g ID=Lus10011965.BGIv1.0 annot-version=v1.0
MSITFRCSSQGFPAGLLQFQGMRNCEACMMEATAFGFRAAVNMDNVKKSALCDDYMELVSEEATLKMVAEIIQRRKKKISELVLNEREQPQHRFPFDKEL
DVLEADLKDVEAEIAAIAKSKEEVKSFLILQREIQRDHLEVRSWVKIAGHR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10011965 0 1
AT5G56520 unknown protein Lus10005700 1.7 0.8630
AT3G59990 MAP2B methionine aminopeptidase 2B (... Lus10010592 3.5 0.8705
AT1G64520 RPN12A regulatory particle non-ATPase... Lus10001813 5.2 0.8424
AT1G17130 Family of unknown function (DU... Lus10013707 7.9 0.8456
AT1G68310 AE7 AS1/2 ENHANCER7, Protein of un... Lus10031006 10.8 0.8706
AT2G05630 ATG8D Ubiquitin-like superfamily pro... Lus10039656 11.0 0.8625
AT5G08420 RNA-binding KH domain-containi... Lus10042479 14.7 0.8085
AT1G48170 unknown protein Lus10011844 14.8 0.8214
AT1G45976 SBP1 S-ribonuclease binding protein... Lus10001131 15.2 0.8352
AT3G10030 Trihelix aspartate/glutamate/uridylate ... Lus10008988 15.5 0.8594

Lus10011965 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.