Lus10011966 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G55140 160 / 1e-52 ribosomal protein L30 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004595 213 / 2e-73 AT5G55140 161 / 6e-53 ribosomal protein L30 family protein (.1)
Lus10031912 209 / 7e-72 AT5G55140 161 / 7e-53 ribosomal protein L30 family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G225600 175 / 2e-58 AT5G55140 154 / 4e-50 ribosomal protein L30 family protein (.1)
Potri.014G157400 170 / 2e-56 AT5G55140 151 / 5e-49 ribosomal protein L30 family protein (.1)
Potri.010G076275 79 / 2e-20 AT5G55140 68 / 2e-16 ribosomal protein L30 family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00327 Ribosomal_L30 Ribosomal protein L30p/L7e
Representative CDS sequence
>Lus10011966 pacid=23161492 polypeptide=Lus10011966 locus=Lus10011966.g ID=Lus10011966.BGIv1.0 annot-version=v1.0
ATGAACGGTTTCAAGGCTTTCAAAGCGCAAGTGCCAATAGCTTGGAGTCCTCGTCTATACATAACTCTTGTCAGAGGGATTCCCGGAACCAGGAGACTCC
ATAGGCGCACCCTCGAGGCATTGTGTCTCACCAAGTGCAACCGGACAGTGACCCGAGAAAATTGTTCTTCCATTAGAGGAATGCTTCAACAGGTGAAGAG
ATTAGTCGTGATCGAGACGGAAGAGATGTACAATGCTCGCAAGGAGAACTACGCAAAGCACAAGGCCGTTCGTCCTCCAGTCGTTATAGGCCACTCTCCA
AATGCTGCGAGCAGCTCTGCGTAG
AA sequence
>Lus10011966 pacid=23161492 polypeptide=Lus10011966 locus=Lus10011966.g ID=Lus10011966.BGIv1.0 annot-version=v1.0
MNGFKAFKAQVPIAWSPRLYITLVRGIPGTRRLHRRTLEALCLTKCNRTVTRENCSSIRGMLQQVKRLVVIETEEMYNARKENYAKHKAVRPPVVIGHSP
NAASSSA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G55140 ribosomal protein L30 family p... Lus10011966 0 1
AT4G39900 unknown protein Lus10041703 6.7 0.8329
AT1G19990 unknown protein Lus10033141 7.5 0.8809
AT1G76860 Small nuclear ribonucleoprotei... Lus10040487 7.7 0.8555
AT3G07590 Small nuclear ribonucleoprotei... Lus10003727 8.6 0.8640
AT1G20580 Small nuclear ribonucleoprotei... Lus10016013 15.2 0.8443
AT2G21060 ATCSP4, ATGRP2B COLD SHOCK DOMAIN PROTEIN 4, g... Lus10034487 16.0 0.8500
AT1G71120 GLIP6 GDSL-motif lipase/hydrolase 6 ... Lus10034635 19.0 0.7473
AT1G72210 bHLH bHLH096 basic helix-loop-helix (bHLH) ... Lus10015902 22.3 0.8432
AT1G76860 Small nuclear ribonucleoprotei... Lus10011293 23.4 0.8155
AT1G32580 plastid developmental protein ... Lus10023744 24.3 0.8353

Lus10011966 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.