Lus10011970 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G18100 228 / 2e-78 Ribosomal protein L32e (.1)
AT5G46430 224 / 3e-77 Ribosomal protein L32e (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012195 245 / 3e-85 AT4G18100 246 / 1e-85 Ribosomal protein L32e (.1)
Lus10007541 245 / 3e-85 AT4G18100 246 / 1e-85 Ribosomal protein L32e (.1)
Lus10004589 242 / 3e-84 AT4G18100 247 / 4e-86 Ribosomal protein L32e (.1)
Lus10020410 241 / 8e-84 AT4G18100 242 / 3e-84 Ribosomal protein L32e (.1)
Lus10031699 240 / 2e-83 AT4G18100 240 / 2e-83 Ribosomal protein L32e (.1)
Lus10009591 241 / 2e-82 AT4G18100 243 / 4e-83 Ribosomal protein L32e (.1)
Lus10031120 242 / 4e-80 AT3G22660 289 / 9e-96 rRNA processing protein-related (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G353900 232 / 4e-80 AT4G18100 227 / 4e-78 Ribosomal protein L32e (.1)
Potri.014G191000 232 / 4e-80 AT4G18100 227 / 4e-78 Ribosomal protein L32e (.1)
Potri.002G249000 229 / 5e-79 AT4G18100 226 / 5e-78 Ribosomal protein L32e (.1)
Potri.011G078200 227 / 4e-78 AT4G18100 225 / 2e-77 Ribosomal protein L32e (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01655 Ribosomal_L32e Ribosomal protein L32
Representative CDS sequence
>Lus10011970 pacid=23161452 polypeptide=Lus10011970 locus=Lus10011970.g ID=Lus10011970.BGIv1.0 annot-version=v1.0
ATGGCGGTGCCACTGTTGACGAAGAAGATCGTGAAGAAGAGGGTCAAACAGTTCAAGAGACCCCAGAGCGATCGGAAGATATGCGTCAAGGAGAACTGGA
GGCGGCCAAAGGGTATTGACTCGAGGGTCAGGAGAAAGTTCAAAGGTGTAACATTGATGCCCAACATCGGTTACGGCTCAGACAAGAAAACCCGACACTA
TCTTCCCAATGGCTTCAAGAAGTTCGTAGTCCACAACGTTAAGGAGCTCGAGGTTCTGATGATGCACAACAGGACCTACTGTGCCGAAATTGCCCATGAC
GTCTCTACCAGAAAGAGAAAGGACATTGTTGAACGTGCCACGCAGTTGGACATTGTCGTCACCAACAAGCTTGCTAGGCTCAGGAGCCAGGAGGACGAGT
AG
AA sequence
>Lus10011970 pacid=23161452 polypeptide=Lus10011970 locus=Lus10011970.g ID=Lus10011970.BGIv1.0 annot-version=v1.0
MAVPLLTKKIVKKRVKQFKRPQSDRKICVKENWRRPKGIDSRVRRKFKGVTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVKELEVLMMHNRTYCAEIAHD
VSTRKRKDIVERATQLDIVVTNKLARLRSQEDE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G18100 Ribosomal protein L32e (.1) Lus10011970 0 1
AT5G15200 Ribosomal protein S4 (.1.2) Lus10008624 1.7 0.9833
AT2G44120 Ribosomal protein L30/L7 famil... Lus10004220 2.8 0.9769
AT4G13850 ATGRP2, GR-RBP2 glycine rich protein 2, glycin... Lus10022551 3.2 0.9627
AT5G35530 Ribosomal protein S3 family pr... Lus10030503 5.2 0.9681
AT5G09510 Ribosomal protein S19 family p... Lus10033856 5.3 0.9636
AT4G16720 Ribosomal protein L23/L15e fam... Lus10028965 6.5 0.9612
AT5G59850 Ribosomal protein S8 family pr... Lus10023429 7.7 0.9407
AT4G09320 NDPK1 Nucleoside diphosphate kinase ... Lus10024286 8.0 0.9457
AT4G16720 Ribosomal protein L23/L15e fam... Lus10007805 10.1 0.9621
AT4G24830 arginosuccinate synthase famil... Lus10012800 10.5 0.9389

Lus10011970 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.