Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G01830 174 / 1e-50 ABCB5, PGP5 ATP-binding cassette B5, P-glycoprotein 5 (.1) AT4G01820 173 / 6e-50 ABCB3, MDR3, PGP3 ATP-binding cassette B3, P-glycoprotein 3 (.1) AT4G18050 167 / 5e-48 ABCB9, PGP9 ATP-binding cassette B9, P-glycoprotein 9 (.1) AT2G47000 167 / 8e-48 PGP4 ,MDR4, ABCB4, ATPGP4 MULTIDRUG RESISTANCE 4, ARABIDOPSIS P-GLYCOPROTEIN 4, ATP-binding cassette B4, ATP binding cassette subfamily B4 (.1) AT5G46540 166 / 2e-47 ABCB7, PGP7 ATP-binding cassette B7, P-glycoprotein 7 (.1) AT1G02520 164 / 6e-47 MDR8, ABCB11, PGP11 multi-drug resistance 8, ATP-binding cassette B11, P-glycoprotein 11 (.1) AT3G62150 163 / 2e-46 ABCB21, PGP21 ATP-binding cassette B21, P-glycoprotein 21 (.1) AT1G02530 160 / 2e-45 ABCB12, PGP12 ATP-binding cassette B12, P-glycoprotein 12 (.1) AT4G25960 118 / 6e-31 ABCB2, PGP2 ATP-binding cassette B2, P-glycoprotein 2 (.1) AT2G36910 115 / 5e-30 ATMDR1, ATPGP1, PGP1, ABCB1 P-GLYCOPROTEIN 1, ARABIDOPSIS THALIANA P GLYCOPROTEIN1, ATP-binding cassette B1, ATP binding cassette subfamily B1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004583 [exp] 224 / 7e-68 AT4G18050 1660 / 0.0 ATP-binding cassette B9, P-glycoprotein 9 (.1) Lus10009988 [exp] 168 / 4e-48 AT3G62150 1896 / 0.0 ATP-binding cassette B21, P-glycoprotein 21 (.1) Lus10010012 [exp] 167 / 4e-48 AT1G02520 1526 / 0.0 multi-drug resistance 8, ATP-binding cassette B11, P-glycoprotein 11 (.1) Lus10010068 [exp] 167 / 5e-48 AT3G62150 1820 / 0.0 ATP-binding cassette B21, P-glycoprotein 21 (.1) Lus10009989 [exp] 167 / 6e-48 AT2G47000 1754 / 0.0 MULTIDRUG RESISTANCE 4, ARABIDOPSIS P-GLYCOPROTEIN 4, ATP-binding cassette B4, ATP binding cassette subfamily B4 (.1) Lus10038049 [exp] 166 / 1e-47 AT3G62150 1891 / 0.0 ATP-binding cassette B21, P-glycoprotein 21 (.1) Lus10038050 [exp] 163 / 2e-46 AT2G47000 1697 / 0.0 MULTIDRUG RESISTANCE 4, ARABIDOPSIS P-GLYCOPROTEIN 4, ATP-binding cassette B4, ATP binding cassette subfamily B4 (.1) Lus10004520 [exp] 162 / 2e-46 AT2G47000 1145 / 0.0 MULTIDRUG RESISTANCE 4, ARABIDOPSIS P-GLYCOPROTEIN 4, ATP-binding cassette B4, ATP binding cassette subfamily B4 (.1) Lus10010067 [exp] 160 / 2e-45 AT1G02520 1748 / 0.0 multi-drug resistance 8, ATP-binding cassette B11, P-glycoprotein 11 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G354900 [exp] 173 / 5e-50 AT4G18050 1723 / 0.0 ATP-binding cassette B9, P-glycoprotein 9 (.1) Potri.014G113000 [exp] 171 / 2e-49 AT3G62150 1767 / 0.0 ATP-binding cassette B21, P-glycoprotein 21 (.1) Potri.002G187400 [exp] 168 / 3e-48 AT3G62150 1702 / 0.0 ATP-binding cassette B21, P-glycoprotein 21 (.1) Potri.002G187500 [exp] 167 / 5e-48 AT3G62150 1860 / 0.0 ATP-binding cassette B21, P-glycoprotein 21 (.1) Potri.014G113200 [exp] 167 / 5e-48 AT3G62150 1871 / 0.0 ATP-binding cassette B21, P-glycoprotein 21 (.1) Potri.014G113500 [exp] 167 / 5e-48 AT3G62150 1879 / 0.0 ATP-binding cassette B21, P-glycoprotein 21 (.1) Potri.014G113400 [exp] 159 / 2e-47 AT3G62150 382 / 4e-122 ATP-binding cassette B21, P-glycoprotein 21 (.1) Potri.014G113100 [exp] 163 / 2e-46 AT1G02520 1773 / 0.0 multi-drug resistance 8, ATP-binding cassette B11, P-glycoprotein 11 (.1) Potri.010G003000 [exp] 160 / 1e-45 AT2G47000 1585 / 0.0 MULTIDRUG RESISTANCE 4, ARABIDOPSIS P-GLYCOPROTEIN 4, ATP-binding cassette B4, ATP binding cassette subfamily B4 (.1) Potri.006G123900 [exp] 122 / 2e-32 AT2G36910 2138 / 0.0 P-GLYCOPROTEIN 1, ARABIDOPSIS THALIANA P GLYCOPROTEIN1, ATP-binding cassette B1, ATP binding cassette subfamily B1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0241 [flax] [poplar] ABC_membrane PF00664 [flax] [poplar] ABC_membrane ABC transporter transmembrane region
Representative CDS sequence Show only first row Show all	>Lus10011978 pacid=23161432 polypeptide=Lus10011978 locus=Lus10011978.g ID=Lus10011978.BGIv1.0 annot-version=v1.0 ATGGTGACAGGAGAAAGGCAATCAGCCCGAATTAGGGCCCTGTACCTGAAGGCAATCCTGAGACAGGACATTGGCTATTTCGACACCGAAACCACCACCG GAGAGGTCATCGGAAGGATGTCTGGCGACATTGTTTTCGTCCAGGACGCCATGGGCGAAAAAGTGGGAAATTTCACACAACAGATGTCTCAGTTCATTAC TGCCTTCATAGTTGCCTTCACAAAAGGATGGCTCTTCACTCTTGTTTTGCTTGTCACCTTACCTATAATCGCCGGAATCGGAGCATGCGTCATGATTTTC ATCTCCCAAACATCGAGCCGCAGACAGCTGGCTTATGTCGACGCTGGAAACTTCGTTGAGCAGACAATCGGAGCCATTAGGACGGCAGCGGCATACAAGA TGTTCGAGACGATCAAACGAGAGCCGAAAATCGACCCTTACGACCAGACTGGGGAAGAATTAGAGAACTTAAAGGGAGAGATTGACATGAAAGACGTGCC TTCAGGTACCCAGCAAGGCCTGACGTACAAATCTTCGAAGGGTTCTCTCTACAAGTACCAAACGGGACGACAGTGGCCTTAG
AA sequence Show only first row Show all	>Lus10011978 pacid=23161432 polypeptide=Lus10011978 locus=Lus10011978.g ID=Lus10011978.BGIv1.0 annot-version=v1.0 MVTGERQSARIRALYLKAILRQDIGYFDTETTTGEVIGRMSGDIVFVQDAMGEKVGNFTQQMSQFITAFIVAFTKGWLFTLVLLVTLPIIAGIGACVMIF ISQTSSRRQLAYVDAGNFVEQTIGAIRTAAAYKMFETIKREPKIDPYDQTGEELENLKGEIDMKDVPSGTQQGLTYKSSKGSLYKYQTGRQWP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G18050		ABCB9, PGP9	ATP-binding cassette B9, P-gly...		Lus10011978 [exp]	0	1

Compare expression of checked genes

Lus10011978 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.