Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G23730 121 / 3e-35 XTH16 xyloglucan endotransglucosylase/hydrolase 16 (.1) AT4G14130 120 / 9e-35 XTR7, XTH15 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) AT4G25810 114 / 3e-32 XTH23, XTR6 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) AT5G48070 111 / 2e-31 XTH20, ATXTH20 xyloglucan endotransglucosylase/hydrolase 20 (.1) AT5G57560 110 / 5e-31 XTH22, TCH4 xyloglucan endotransglucosylase/hydrolase 22, Touch 4, Xyloglucan endotransglucosylase/hydrolase family protein (.1) AT5G57550 110 / 6e-31 XTR3, XTH25, EXGT-A5 xyloglucan endotransglycosylase 3, xyloglucan endotransglucosylase/hydrolase 25 (.1) AT4G30290 108 / 2e-30 XTH19, ATXTH19 xyloglucan endotransglucosylase/hydrolase 19 (.1) AT4G30270 105 / 2e-29 XTH24, SEN4, BRU1, MERI-5, MERI5B SENESCENCE 4, meristem-5, MERISTEM 5, xyloglucan endotransglucosylase/hydrolase 24 (.1) AT1G65310 104 / 8e-29 XTH17, XTR1, ATXTH17 xyloglucan endotransglucosylase/hydrolase 17 (.1) AT4G30280 103 / 4e-28 XTH18, ATXTH18 xyloglucan endotransglucosylase/hydrolase 18 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028947 [exp] 123 / 7e-36 AT4G14130 437 / 2e-156 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Lus10021638 [exp] 118 / 4e-34 AT3G23730 413 / 7e-147 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10000678 [exp] 118 / 5e-34 AT3G23730 410 / 6e-146 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10008522 [exp] 109 / 2e-30 AT3G23730 430 / 2e-153 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10010938 [exp] 108 / 4e-30 AT4G14130 386 / 3e-136 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Lus10031392 [exp] 108 / 4e-30 AT3G23730 384 / 3e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10031393 [exp] 108 / 5e-30 AT3G23730 388 / 8e-137 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10010939 [exp] 107 / 7e-30 AT3G23730 384 / 2e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10004723 [exp] 105 / 5e-29 AT3G23730 431 / 1e-153 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G077320 [exp] 127 / 3e-37 AT3G23730 386 / 7e-136 xyloglucan endotransglucosylase/hydrolase 16 (.1) Potri.014G146100 [exp] 124 / 4e-36 AT3G23730 451 / 1e-161 xyloglucan endotransglucosylase/hydrolase 16 (.1) Potri.005G201200 [exp] 117 / 1e-33 AT4G14130 405 / 2e-143 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Potri.005G201250 [exp] 117 / 2e-33 AT4G14130 395 / 2e-139 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Potri.002G060500 [exp] 115 / 5e-33 AT4G14130 424 / 3e-151 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Potri.002G236200 [exp] 115 / 7e-33 AT3G23730 436 / 1e-155 xyloglucan endotransglucosylase/hydrolase 16 (.1) Potri.002G060400 [exp] 112 / 9e-32 AT4G14130 402 / 2e-142 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Potri.018G094900 [exp] 109 / 1e-30 AT4G25810 410 / 8e-146 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Potri.018G095200 [exp] 107 / 9e-30 AT4G25810 414 / 3e-147 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Potri.018G095100 [exp] 105 / 3e-29 AT4G25810 420 / 1e-149 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0004 [flax] [poplar] Concanavalin PF06955 [flax] [poplar] XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence Show only first row Show all	>Lus10011983 pacid=23161397 polypeptide=Lus10011983 locus=Lus10011983.g ID=Lus10011983.BGIv1.0 annot-version=v1.0 ATGAAGCTGTATTCAAGCCTGTGGGACGCAGATCAATGGGCCACGAGAGGTGGGCTTGTGAAGACGGACTGGTCAAGGGCTCTTTTCACGGCCTACTACA GGAACTTCAACACCAAGTCTTCTTCTTCTTCTAATTATAAGCCGGCGGTGGGTAATACCGGCGACGATTGGCGAACTCAGAAGCTGGACGCCGGCGGGAG GAGATGGATTAAGTGGGCCCAGAAGTACCACATGATTTATAATTATTGCTCCGATCTCAAGCGCTTCCTGCACGGCCGCCCACGTGAGTGCCGGCGTTAC TGA
AA sequence Show only first row Show all	>Lus10011983 pacid=23161397 polypeptide=Lus10011983 locus=Lus10011983.g ID=Lus10011983.BGIv1.0 annot-version=v1.0 MKLYSSLWDADQWATRGGLVKTDWSRALFTAYYRNFNTKSSSSSNYKPAVGNTGDDWRTQKLDAGGRRWIKWAQKYHMIYNYCSDLKRFLHGRPRECRRY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G23730		XTH16	xyloglucan endotransglucosylas...		Lus10011983 [exp]	0	1
AT4G28050		TET7	tetraspanin7 (.1)		Lus10038964 [exp]	8.7	0.8532
AT3G57440			unknown protein		Lus10042062 [exp]	10.4	0.8687
AT2G04865			Aminotransferase-like, plant m...		Lus10003728 [exp]	15.0	0.8452
AT1G67623			F-box family protein (.1)		Lus10006434 [exp]	15.6	0.8604
AT3G03000			EF hand calcium-binding protei...		Lus10004539 [exp]	19.0	0.8582
AT3G59030		ATTT12, TT12	TRANSPARENT TESTA 12, A. THALI...		Lus10017639 [exp]	19.3	0.6855
AT4G10955			alpha/beta-Hydrolases superfam...		Lus10023072 [exp]	23.6	0.7571
AT2G43610			Chitinase family protein (.1)		Lus10001772 [exp]	24.8	0.8530
AT1G02335		GL22	germin-like protein subfamily ...		Lus10020632 [exp]	28.1	0.8507
AT5G33340		CDR1	CONSTITUTIVE DISEASE RESISTANC...		Lus10024910 [exp]	29.3	0.8501

Compare expression of checked genes

Lus10011983 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.