Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G25810 185 / 2e-59 XTH23, XTR6 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) AT4G30270 182 / 2e-58 XTH24, SEN4, BRU1, MERI-5, MERI5B SENESCENCE 4, meristem-5, MERISTEM 5, xyloglucan endotransglucosylase/hydrolase 24 (.1) AT3G23730 179 / 7e-57 XTH16 xyloglucan endotransglucosylase/hydrolase 16 (.1) AT5G57550 174 / 4e-55 XTR3, XTH25, EXGT-A5 xyloglucan endotransglycosylase 3, xyloglucan endotransglucosylase/hydrolase 25 (.1) AT4G14130 172 / 2e-54 XTR7, XTH15 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) AT5G57560 171 / 5e-54 XTH22, TCH4 xyloglucan endotransglucosylase/hydrolase 22, Touch 4, Xyloglucan endotransglucosylase/hydrolase family protein (.1) AT2G18800 165 / 2e-51 ATXTH21, XTH21, XTR17 xyloglucan endotransglucosylase/hydrolase 21 (.1) AT4G25820 164 / 5e-51 ATXTH14, XTR9, XTH14 xyloglucan endotransglycosylase 9, xyloglucan endotransglucosylase/hydrolase 14 (.1) AT5G57540 163 / 1e-50 AtXTH13, XTH13 xyloglucan endotransglucosylase/hydrolase 13 (.1) AT5G57530 160 / 9e-50 AtXTH12, XTH12 xyloglucan endotransglucosylase/hydrolase 12 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028947 [exp] 182 / 3e-58 AT4G14130 437 / 2e-156 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Lus10010939 [exp] 180 / 2e-57 AT3G23730 384 / 2e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10031393 [exp] 180 / 2e-57 AT3G23730 388 / 8e-137 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10031392 [exp] 180 / 3e-57 AT3G23730 384 / 3e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10010938 [exp] 177 / 2e-56 AT4G14130 386 / 3e-136 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Lus10007349 [exp] 177 / 3e-56 AT3G23730 394 / 4e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10020772 [exp] 176 / 6e-56 AT3G23730 393 / 7e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10004723 [exp] 176 / 7e-56 AT3G23730 431 / 1e-153 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10008522 [exp] 176 / 8e-56 AT3G23730 430 / 2e-153 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G077320 [exp] 194 / 8e-63 AT3G23730 386 / 7e-136 xyloglucan endotransglucosylase/hydrolase 16 (.1) Potri.014G146100 [exp] 189 / 7e-61 AT3G23730 451 / 1e-161 xyloglucan endotransglucosylase/hydrolase 16 (.1) Potri.011G077380 [exp] 185 / 4e-59 AT4G14130 345 / 2e-119 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Potri.005G201250 [exp] 182 / 5e-58 AT4G14130 395 / 2e-139 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Potri.005G201200 [exp] 181 / 1e-57 AT4G14130 405 / 2e-143 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Potri.002G060500 [exp] 179 / 5e-57 AT4G14130 424 / 3e-151 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Potri.002G236200 [exp] 178 / 1e-56 AT3G23730 436 / 1e-155 xyloglucan endotransglucosylase/hydrolase 16 (.1) Potri.013G005700 [exp] 177 / 8e-56 AT4G25810 431 / 5e-153 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Potri.018G094800 [exp] 176 / 1e-55 AT4G25810 413 / 1e-146 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Potri.006G071200 [exp] 175 / 1e-55 AT4G25810 379 / 3e-133 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0004 [flax] [poplar] Concanavalin PF00722 [flax] [poplar] Glyco_hydro_16 Glycosyl hydrolases family 16
Representative CDS sequence Show only first row Show all	>Lus10011984 pacid=23161395 polypeptide=Lus10011984 locus=Lus10011984.g ID=Lus10011984.BGIv1.0 annot-version=v1.0 ATGATAAAGCTGGTTCCATTTCCAGTTAACTCTGCAGCCAACTTCAACCAAGAAGTCGACCTGACATGGGGAGGCGACCGTGGCCGAATCTCCGATGGCG GCGATACCCTCTCCCTCGACAAAGACTCCGGCTCTGGTTTTCAGTCCAAGAGAGCTATTCTCTTCGGCAAGATCGACATGGACATCAAGCTCGTCGCTGG CAACTCCGCTGGCACAGTCACCGCCTTCTACTTGTCATCTGAAGGGCCATTCGACACCCATGACGAGATCGATTTCGAGTTCTTAGGGAATCTCAGCGGA GATCCGTACACTCTGCACACCAATGTGTATACTAACGACAAAGGTGGCAGAGAGCAACAGTTTCGGCTTTGGTTTGATCCTACTAAGAAGTTTCACACCT ACTCCATCGTGTGGAATCCTCAACGTATCATGTAA
AA sequence Show only first row Show all	>Lus10011984 pacid=23161395 polypeptide=Lus10011984 locus=Lus10011984.g ID=Lus10011984.BGIv1.0 annot-version=v1.0 MIKLVPFPVNSAANFNQEVDLTWGGDRGRISDGGDTLSLDKDSGSGFQSKRAILFGKIDMDIKLVAGNSAGTVTAFYLSSEGPFDTHDEIDFEFLGNLSG DPYTLHTNVYTNDKGGREQQFRLWFDPTKKFHTYSIVWNPQRIM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G25810		XTH23, XTR6	xyloglucan endotransglucosylas...		Lus10011984 [exp]	0	1
AT1G06640			2-oxoglutarate (2OG) and Fe(II...		Lus10009238 [exp]	14.5	0.8498
AT1G07570		APK1A	Protein kinase superfamily pro...		Lus10002697 [exp]	16.4	0.8710
AT1G10430		PP2A-2	protein phosphatase 2A-2 (.1)		Lus10013287 [exp]	21.9	0.8672
AT1G27430			GYF domain-containing protein ...		Lus10035192 [exp]	22.1	0.8511
AT1G64230		UBC28	ubiquitin-conjugating enzyme 2...		Lus10022726 [exp]	24.5	0.8671
AT5G56520			unknown protein		Lus10005700 [exp]	27.9	0.8160
AT1G80290			Nucleotide-diphospho-sugar tra...		Lus10020174 [exp]	31.7	0.8461
AT2G26430		ATRCY1, RCY1	arginine-rich cyclin 1 (.1.2.3...		Lus10041418 [exp]	32.7	0.8663
AT1G01720	NAC	ATAF1, ANAC002	Arabidopsis NAC domain contain...		Lus10025690 [exp]	33.4	0.8556
AT2G30140			UDP-Glycosyltransferase superf...		Lus10042263 [exp]	40.8	0.8241

Compare expression of checked genes

Lus10011984 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.