Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003349 [exp] 89 / 5e-22 AT1G46912 48 / 2e-05 F-box associated ubiquitination effector family protein (.1.2) Lus10013907 [exp] 81 / 1e-19 ND / Lus10007301 [exp] 67 / 1e-14 ND / Lus10013987 [exp] 63 / 4e-13 AT3G23950 59 / 1e-08 F-box family protein (.1) Lus10004929 [exp] 58 / 3e-11 ND / Lus10001847 [exp] 54 / 4e-10 AT5G20140 330 / 3e-111 SOUL heme-binding family protein (.1.2) Lus10035075 [exp] 53 / 4e-10 AT5G20140 50 / 4e-08 SOUL heme-binding family protein (.1.2) Lus10013345 [exp] 0 / 1 AT5G20140 464 / 8e-164 SOUL heme-binding family protein (.1.2)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10011992 pacid=23161501 polypeptide=Lus10011992 locus=Lus10011992.g ID=Lus10011992.BGIv1.0 annot-version=v1.0 ATGAACGATGGTGATGTCGTTCATGATTCTTCCATGGAGGCCGGAGTTGGTGTTCATAGGGACTTCTGCAATGGGGTCAATCCAAGTGACGGGGAGTTTT GCAGCCGTGTGGTAGTCTCTATCGAAAGTGTCTGTACTAGGAACATGGTGGTTCCGAGTAGGAAGCGCAAACTCGGCGGGATGGTGATAACAGAAAGGAA GCAGCCTCGTTTTGTTGATGACAAGGAAGCTGGTTTCAAAGACGTTGTTGTTGAAGATTAA
AA sequence Show only first row Show all	>Lus10011992 pacid=23161501 polypeptide=Lus10011992 locus=Lus10011992.g ID=Lus10011992.BGIv1.0 annot-version=v1.0 MNDGDVVHDSSMEAGVGVHRDFCNGVNPSDGEFCSRVVVSIESVCTRNMVVPSRKRKLGGMVITERKQPRFVDDKEAGFKDVVVED

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10011992 [exp]	0	1
AT1G53050			Protein kinase superfamily pro...		Lus10005801 [exp]	3.2	0.8152
					Lus10007398 [exp]	16.1	0.8330
AT1G73830	bHLH	bHLH050, BEE3	BR enhanced expression 3 (.1.2...		Lus10038939 [exp]	24.8	0.8081
AT1G09190			Tetratricopeptide repeat (TPR)...		Lus10034889 [exp]	29.9	0.8281
AT5G41040			HXXXD-type acyl-transferase fa...		Lus10035188 [exp]	182.0	0.7715
AT5G53980	HD	ATHB52	homeobox protein 52 (.1)		Lus10003492 [exp]	200.8	0.7541
AT5G14360			Ubiquitin-like superfamily pro...		Lus10014884 [exp]	213.0	0.7394
AT3G50660		PSC1, CYP90B1, ...	SUPPRESSOR OF NPH4 2, SHADE AV...		Lus10016065 [exp]	219.7	0.7828

Compare expression of checked genes

Lus10011992 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.