Lus10012008 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G12120 248 / 1e-82 FAD2 fatty acid desaturase 2 (.1.2)
AT2G29980 106 / 1e-28 AtFAD3, FAD3 fatty acid desaturase 3 (.1.2)
AT5G05580 103 / 4e-27 AtFAD8, SH1, FAD8 fatty acid desaturase 8 (.1.2)
AT3G11170 103 / 9e-27 AtFAD7, FADD, FAD7 FATTY ACID DESATURASE D, fatty acid desaturase 7 (.1)
AT4G30950 66 / 5e-13 FADC, SFD4, FAD6 STEAROYL DESATURASE DEFICIENCY 4, FATTY ACID DESATURASE C, fatty acid desaturase 6 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029284 303 / 1e-107 AT3G12120 245 / 1e-81 fatty acid desaturase 2 (.1.2)
Lus10004175 284 / 1e-96 AT3G12120 635 / 0.0 fatty acid desaturase 2 (.1.2)
Lus10021051 283 / 2e-96 AT3G12120 634 / 0.0 fatty acid desaturase 2 (.1.2)
Lus10021045 220 / 6e-72 AT3G12120 500 / 2e-178 fatty acid desaturase 2 (.1.2)
Lus10004176 220 / 7e-72 AT3G12120 519 / 0.0 fatty acid desaturase 2 (.1.2)
Lus10021050 218 / 5e-71 AT3G12120 521 / 0.0 fatty acid desaturase 2 (.1.2)
Lus10004178 217 / 2e-70 AT3G12120 532 / 0.0 fatty acid desaturase 2 (.1.2)
Lus10004177 214 / 2e-69 AT3G12120 508 / 0.0 fatty acid desaturase 2 (.1.2)
Lus10021047 213 / 4e-69 AT3G12120 502 / 9e-179 fatty acid desaturase 2 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G192000 256 / 5e-86 AT3G12120 629 / 0.0 fatty acid desaturase 2 (.1.2)
Potri.016G046200 251 / 1e-83 AT3G12120 624 / 0.0 fatty acid desaturase 2 (.1.2)
Potri.001G012500 219 / 3e-72 AT3G12120 480 / 3e-171 fatty acid desaturase 2 (.1.2)
Potri.001G012700 214 / 1e-69 AT3G12120 553 / 0.0 fatty acid desaturase 2 (.1.2)
Potri.001G012401 215 / 4e-69 AT3G12120 571 / 0.0 fatty acid desaturase 2 (.1.2)
Potri.001G252900 109 / 3e-29 AT2G29980 539 / 0.0 fatty acid desaturase 3 (.1.2)
Potri.016G117500 109 / 1e-28 AT5G05580 592 / 0.0 fatty acid desaturase 8 (.1.2)
Potri.006G101500 107 / 6e-28 AT5G05580 632 / 0.0 fatty acid desaturase 8 (.1.2)
Potri.010G187800 106 / 1e-27 AT5G05580 683 / 0.0 fatty acid desaturase 8 (.1.2)
Potri.008G069600 102 / 3e-26 AT5G05580 689 / 0.0 fatty acid desaturase 8 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00487 FA_desaturase Fatty acid desaturase
PF11960 DUF3474 Domain of unknown function (DUF3474)
Representative CDS sequence
>Lus10012008 pacid=23161460 polypeptide=Lus10012008 locus=Lus10012008.g ID=Lus10012008.BGIv1.0 annot-version=v1.0
ATGGGTGCCGGTGGCAGAATGTCAGTGCCTCCATCATCCAAACCTATGAAGAGGTCTCCTTACTCAAAGCCACCATTCACGCTCGGTGAGCTCAAGAAGG
CCATCCCTCCACACTGTTTCAAACGCTCAATCCCCCGATCGTTCGCCTACGTGGCGTACGACCTCACCATTGCAGCAATCTTCTACTACATCGCCACCAC
TTACTTCCACCTCCTCCCTAGCCCTCTCAACTACCTCGCCTGGCCGGTCTACTGGGCCTGCCAGGGCTGCATCCTCACTGGAGTATGGGTGTTGGCTCAC
GAATGCGGTCACCATGCCTTCAGCGACTACCAGTGGCTCGACGACATGGTTGGCTTCGTCCTCCATTCGTCCCTCCTTGTTCCTTACTTCTCCTGGAAGC
ACAGCCACCGCCGCCACCATTCAAACACGGGGTCGCTTCTCCGGGAGACCATATGA
AA sequence
>Lus10012008 pacid=23161460 polypeptide=Lus10012008 locus=Lus10012008.g ID=Lus10012008.BGIv1.0 annot-version=v1.0
MGAGGRMSVPPSSKPMKRSPYSKPPFTLGELKKAIPPHCFKRSIPRSFAYVAYDLTIAAIFYYIATTYFHLLPSPLNYLAWPVYWACQGCILTGVWVLAH
ECGHHAFSDYQWLDDMVGFVLHSSLLVPYFSWKHSHRRHHSNTGSLLRETI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G12120 FAD2 fatty acid desaturase 2 (.1.2) Lus10012008 0 1
AT3G12120 FAD2 fatty acid desaturase 2 (.1.2) Lus10029284 1.0 0.8965
AT3G12120 FAD2 fatty acid desaturase 2 (.1.2) Lus10029283 2.0 0.8195
AT3G12120 FAD2 fatty acid desaturase 2 (.1.2) Lus10012007 2.8 0.7860
AT3G02630 Plant stearoyl-acyl-carrier-pr... Lus10039241 4.6 0.8138
AT2G16890 UDP-Glycosyltransferase superf... Lus10022220 6.3 0.7603
AT5G09650 ATPPA6 pyrophosphorylase 6 (.1) Lus10035653 8.7 0.7245
AT4G30950 FADC, SFD4, FAD... STEAROYL DESATURASE DEFICIENCY... Lus10035831 13.6 0.7646
AT1G08470 SSL3 strictosidine synthase-like 3 ... Lus10013370 14.7 0.7649
AT3G02630 Plant stearoyl-acyl-carrier-pr... Lus10027486 18.3 0.7667
AT3G02580 BUL1, DWF7, STE... DWARF 7, BOULE 1, sterol 1 (.1... Lus10009147 23.2 0.7078

Lus10012008 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.