Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G06760 68 / 1e-15 AtLEA4-5, LEA4-5 Late Embryogenesis Abundant 4-5 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016266 [exp] 135 / 4e-43 AT5G06760 68 / 1e-15 Late Embryogenesis Abundant 4-5 (.1) Lus10021044 [exp] 97 / 6e-26 AT5G06760 87 / 8e-21 Late Embryogenesis Abundant 4-5 (.1) Lus10016273 [exp] 92 / 7e-25 AT5G06760 120 / 3e-35 Late Embryogenesis Abundant 4-5 (.1) Lus10012018 [exp] 87 / 6e-23 AT5G06760 123 / 3e-36 Late Embryogenesis Abundant 4-5 (.1) Lus10004182 [exp] 83 / 3e-21 AT5G06760 87 / 1e-21 Late Embryogenesis Abundant 4-5 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G046350 [exp] 64 / 4e-14 AT5G06760 101 / 2e-27 Late Embryogenesis Abundant 4-5 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03760 [flax] [poplar] LEA_1 Late embryogenesis abundant (LEA) group 1
Representative CDS sequence Show only first row Show all	>Lus10012009 pacid=23161426 polypeptide=Lus10012009 locus=Lus10012009.g ID=Lus10012009.BGIv1.0 annot-version=v1.0 ATGCAGCCCGCGAAGGAAACCGCTTCCAACATCGCCGCCTCCGCCAAGTCCGGCATGGACAAGACCAAAGCCGTCGCCCAGGAACAGGTGGACAAGGTAT CGGCCCATGGCCCGATGGGGAAAGAGATGGCTAGGGAGAAGAAGGACGCGAGGGTGGCAGAGGCGGAGGCGACGAAGCGCGAGGCGAAGATGCAGAATGC GGCGGCGAGGCAAGGTGAGCAGGTGACGGGCGGGTATGGAAACTACACCACTGGTGGACAGACTGGTTATAACCATCAGATATGA
AA sequence Show only first row Show all	>Lus10012009 pacid=23161426 polypeptide=Lus10012009 locus=Lus10012009.g ID=Lus10012009.BGIv1.0 annot-version=v1.0 MQPAKETASNIAASAKSGMDKTKAVAQEQVDKVSAHGPMGKEMAREKKDARVAEAEATKREAKMQNAAARQGEQVTGGYGNYTTGGQTGYNHQI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G06760		AtLEA4-5, LEA4-...	Late Embryogenesis Abundant 4-...		Lus10012009 [exp]	0	1
AT4G28940			Phosphorylase superfamily prot...		Lus10034939 [exp]	1.0	0.9166
AT4G17905		ATL4H	RING/U-box superfamily protein...		Lus10027736 [exp]	16.9	0.8725
AT2G01170		BAT1	bidirectional amino acid trans...		Lus10028561 [exp]	22.4	0.7865
AT1G80320			2-oxoglutarate (2OG) and Fe(II...		Lus10041279 [exp]	22.8	0.8402
AT5G18170		GDH1	glutamate dehydrogenase 1 (.1)		Lus10003858 [exp]	24.4	0.8546
AT5G27350		SFP1	Major facilitator superfamily ...		Lus10035355 [exp]	28.1	0.8157
AT4G24000		ATCSLG2	ARABIDOPSIS THALIANA CELLULOSE...		Lus10032416 [exp]	29.2	0.8496
AT2G35830			unknown protein		Lus10040372 [exp]	30.6	0.8644
AT5G08240			unknown protein		Lus10040984 [exp]	32.3	0.8719
AT5G45890		SAG12	senescence-associated gene 12 ...		Lus10028501 [exp]	34.3	0.8405

Compare expression of checked genes

Lus10012009 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.