Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G12130 66 / 1e-14 C3HZnF KH domain-containing protein / zinc finger (CCCH type) family protein (.1) AT5G06770 54 / 3e-10 C3HZnF KH domain-containing protein / zinc finger (CCCH type) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016272 [exp] 134 / 2e-40 AT3G12130 229 / 5e-75 KH domain-containing protein / zinc finger (CCCH type) family protein (.1) Lus10012017 [exp] 77 / 3e-19 AT3G12130 186 / 8e-60 KH domain-containing protein / zinc finger (CCCH type) family protein (.1) Lus10004183 [exp] 72 / 3e-16 AT5G06770 261 / 8e-86 KH domain-containing protein / zinc finger (CCCH type) family protein (.1) Lus10021043 [exp] 70 / 9e-16 AT5G06770 262 / 1e-87 KH domain-containing protein / zinc finger (CCCH type) family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G046600 [exp] 62 / 5e-13 AT5G06770 265 / 2e-89 KH domain-containing protein / zinc finger (CCCH type) family protein (.1) Potri.006G191900 [exp] 59 / 4e-12 AT3G12130 256 / 2e-85 KH domain-containing protein / zinc finger (CCCH type) family protein (.1) Potri.001G013200 [exp] 58 / 1e-11 AT5G06770 169 / 2e-51 KH domain-containing protein / zinc finger (CCCH type) family protein (.1) Potri.003G213200 [exp] 56 / 5e-11 AT5G06770 162 / 1e-48 KH domain-containing protein / zinc finger (CCCH type) family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10012015 pacid=23161398 polypeptide=Lus10012015 locus=Lus10012015.g ID=Lus10012015.BGIv1.0 annot-version=v1.0 ATGCCAACCGTTCCATCCCATAACAAACATAGTATGAGCCATACAGACTCACCCCTTCCGGCTCCTACTGCTGGTTTTGGCGATACTGAAACTGTAAAAA TCAGCATCGCCGCAACCCTCGCAGGGACCATAATCGGGAACTCGATGCAGATATGTAGGCAGACGGGAGTGAAGCTATCGATGGGGGATCACGAAGCGGA TCCCATTAACTTGAGGAACATCTAG
AA sequence Show only first row Show all	>Lus10012015 pacid=23161398 polypeptide=Lus10012015 locus=Lus10012015.g ID=Lus10012015.BGIv1.0 annot-version=v1.0 MPTVPSHNKHSMSHTDSPLPAPTAGFGDTETVKISIAATLAGTIIGNSMQICRQTGVKLSMGDHEADPINLRNI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G12130	C3HZnF		KH domain-containing protein /...		Lus10012015 [exp]	0	1
AT3G12130	C3HZnF		KH domain-containing protein /...		Lus10012016 [exp]	5.7	0.6936
AT5G46090			Protein of unknown function (D...		Lus10033645 [exp]	30.5	0.5728
AT1G62930		RPF3	RNA processing factor 3, Tetra...		Lus10003446 [exp]	38.9	0.5466
AT4G26680			Tetratricopeptide repeat (TPR)...		Lus10020371 [exp]	41.8	0.5635
AT4G13750		EMB2597, NOV	NO VEIN, EMBRYO DEFECTIVE 2597...		Lus10037831 [exp]	72.2	0.5578
AT3G49740			Tetratricopeptide repeat (TPR)...		Lus10011562 [exp]	79.3	0.5454
AT5G39020			Malectin/receptor-like protein...		Lus10008333 [exp]	88.3	0.5377
AT5G07630			lipid transporters (.1)		Lus10027222 [exp]	100.7	0.5098
AT2G40340	AP2_ERF	AtERF48, DREB2C	Integrase-type DNA-binding sup...		Lus10034902 [exp]	118.9	0.5075
AT1G21550			Calcium-binding EF-hand family...		Lus10029730 [exp]	130.8	0.5038

Compare expression of checked genes

Lus10012015 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.