Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G12130 72 / 4e-17 C3HZnF KH domain-containing protein / zinc finger (CCCH type) family protein (.1) AT5G06770 72 / 6e-17 C3HZnF KH domain-containing protein / zinc finger (CCCH type) family protein (.1) AT1G32360 47 / 6e-08 C3HZnF Zinc finger (CCCH-type) family protein (.1) AT3G19360 44 / 8e-07 C3HZnF Zinc finger (CCCH-type) family protein (.1) AT2G35430 39 / 5e-05 C3HZnF Zinc finger C-x8-C-x5-C-x3-H type family protein (.1) AT2G28450 37 / 0.0004 C3HZnF zinc finger (CCCH-type) family protein (.1), zinc finger (CCCH-type) family protein (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016272 [exp] 107 / 3e-30 AT3G12130 229 / 5e-75 KH domain-containing protein / zinc finger (CCCH type) family protein (.1) Lus10021043 [exp] 92 / 3e-24 AT5G06770 262 / 1e-87 KH domain-containing protein / zinc finger (CCCH type) family protein (.1) Lus10004183 [exp] 89 / 1e-22 AT5G06770 261 / 8e-86 KH domain-containing protein / zinc finger (CCCH type) family protein (.1) Lus10012017 [exp] 83 / 6e-22 AT3G12130 186 / 8e-60 KH domain-containing protein / zinc finger (CCCH type) family protein (.1) Lus10004573 [exp] 46 / 3e-07 AT1G32360 342 / 1e-116 Zinc finger (CCCH-type) family protein (.1) Lus10000486 [exp] 45 / 3e-07 AT1G32360 337 / 6e-115 Zinc finger (CCCH-type) family protein (.1) Lus10043287 [exp] 42 / 7e-06 AT3G19360 290 / 7e-96 Zinc finger (CCCH-type) family protein (.1) Lus10019431 [exp] 42 / 7e-06 AT3G19360 266 / 2e-87 Zinc finger (CCCH-type) family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G046600 [exp] 83 / 6e-21 AT5G06770 265 / 2e-89 KH domain-containing protein / zinc finger (CCCH type) family protein (.1) Potri.006G191900 [exp] 79 / 1e-19 AT3G12130 256 / 2e-85 KH domain-containing protein / zinc finger (CCCH type) family protein (.1) Potri.001G013200 [exp] 70 / 5e-16 AT5G06770 169 / 2e-51 KH domain-containing protein / zinc finger (CCCH type) family protein (.1) Potri.003G213200 [exp] 69 / 1e-15 AT5G06770 162 / 1e-48 KH domain-containing protein / zinc finger (CCCH type) family protein (.1) Potri.001G140800 [exp] 44 / 1e-06 AT1G32360 355 / 3e-121 Zinc finger (CCCH-type) family protein (.1) Potri.003G093600 [exp] 43 / 2e-06 AT1G32360 353 / 2e-120 Zinc finger (CCCH-type) family protein (.1) Potri.009G130600 [exp] 43 / 2e-06 AT3G19360 276 / 9e-91 Zinc finger (CCCH-type) family protein (.1) Potri.004G169500 [exp] 43 / 2e-06 AT3G19360 284 / 1e-93 Zinc finger (CCCH-type) family protein (.1) Potri.003G061600 [exp] 39 / 9e-05 AT3G19360 109 / 1e-27 Zinc finger (CCCH-type) family protein (.1) Potri.005G061100 [exp] 36 / 0.0006 AT3G18640 140 / 2e-34 Zinc finger C-x8-C-x5-C-x3-H type family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0537 [flax] [poplar] CCCH_zf PF00642 [flax] [poplar] zf-CCCH Zinc finger C-x8-C-x5-C-x3-H type (and similar)
Representative CDS sequence Show only first row Show all	>Lus10012016 pacid=23161482 polypeptide=Lus10012016 locus=Lus10012016.g ID=Lus10012016.BGIv1.0 annot-version=v1.0 ATGTTGACGGAGCTGATTGCAAACATTGGGGGTCCATCCTCCGGAGGAGGAGCAGGGCATGTCAGGAAATCGTCCGGGGAGAAGCATCATCCGGGAAGCA ACTACAAGACGAAGATATGCGACAATTTTGTTAAAGGGTCTTGCACCTTCGGCGAAAGATGCCATTTTGCTCATGGTGCTGCTGAAATGCGGAAGACTGC TGTATGA
AA sequence Show only first row Show all	>Lus10012016 pacid=23161482 polypeptide=Lus10012016 locus=Lus10012016.g ID=Lus10012016.BGIv1.0 annot-version=v1.0 MLTELIANIGGPSSGGGAGHVRKSSGEKHHPGSNYKTKICDNFVKGSCTFGERCHFAHGAAEMRKTAV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G12130	C3HZnF		KH domain-containing protein /...		Lus10012016 [exp]	0	1
AT4G13750		EMB2597, NOV	NO VEIN, EMBRYO DEFECTIVE 2597...		Lus10037831 [exp]	1.0	0.8136
AT4G26680			Tetratricopeptide repeat (TPR)...		Lus10020371 [exp]	2.4	0.7775
AT3G12130	C3HZnF		KH domain-containing protein /...		Lus10012015 [exp]	5.7	0.6936
					Lus10008602 [exp]	6.1	0.6817
AT5G39020			Malectin/receptor-like protein...		Lus10008333 [exp]	8.5	0.8079
					Lus10002965 [exp]	12.2	0.6287
AT1G21550			Calcium-binding EF-hand family...		Lus10029730 [exp]	12.6	0.6236
AT5G56990			unknown protein		Lus10029528 [exp]	15.4	0.7716
					Lus10038051 [exp]	17.2	0.7716
					Lus10003825 [exp]	18.8	0.7716

Compare expression of checked genes

Lus10012016 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.