Plant FIBer expression Database

Lus10012024 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G42210 193 / 4e-64 ATOEP16-3 Mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 family protein (.1.2.3.4)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016278
[exp]
256 / 1e-88 AT2G42210 246 / 1e-84 Mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 family protein (.1.2.3.4)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G059300
[exp]
196 / 4e-65 AT2G42210 218 / 1e-73 Mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 family protein (.1.2.3.4)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02466 Tim17 Tim17/Tim22/Tim23/Pmp24 family
Representative CDS sequence
>Lus10012024 pacid=23161493 polypeptide=Lus10012024 locus=Lus10012024.g ID=Lus10012024.BGIv1.0 annot-version=v1.0
ATGGATTCATCAGAGATGAGGTATTTGGAGGACGATAGCACTCCGACCATGAAAACTTTGAAGGGTGCGACCATGGGATTAGTTACCGGAACTATTTGGG
GTACCATTATTGCCACTTGGCATGATGTGCCTCGTGTTGAGAAGCACGTCGCACTCCCAGGGCTAATAAGGACCCTGAAGATGATGGGCAGTTACGGCTC
GACTTTTGCTGCTATCGGAGGTATTTACATTGGTATTGAGCAGCTGCTGGAGCAACAAAGAGCAAAGAGAGATTTCATTAATGGAGCTGTTGGTGGTTTT
GTCGCTGGAGCTTCTGTACTTGGCTTGAGAGCAAGGAGCATCCCAACAGCTATTTCTGCAGGAGCGGCACTGGCTGTTACCTCTGCCCTGATCGATGCCG
GAGGCCAGACCACAAGAGTAGACACCGGCAAGGAGTATTACCCTTACACCACCAAGAAGAGATCCACCGCCGATGCATAG
AA sequence
>Lus10012024 pacid=23161493 polypeptide=Lus10012024 locus=Lus10012024.g ID=Lus10012024.BGIv1.0 annot-version=v1.0
MDSSEMRYLEDDSTPTMKTLKGATMGLVTGTIWGTIIATWHDVPRVEKHVALPGLIRTLKMMGSYGSTFAAIGGIYIGIEQLLEQQRAKRDFINGAVGGF
VAGASVLGLRARSIPTAISAGAALAVTSALIDAGGQTTRVDTGKEYYPYTTKKRSTADA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G42210 ATOEP16-3 Mitochondrial import inner mem... Lus10012024
[exp]
0 1
AT5G11280 unknown protein Lus10002030
[exp]
1.4 0.9456
AT2G02050 NADH-ubiquinone oxidoreductase... Lus10019137
[exp]
2.4 0.9413
AT5G52840 NADH-ubiquinone oxidoreductase... Lus10027539
[exp]
3.2 0.9364
AT5G13450 ATP5 delta subunit of Mt ATP syntha... Lus10019706
[exp]
3.5 0.9406
AT1G19580 GAMMACA1 ,GAMMA... gamma carbonic anhydrase 1 (.1... Lus10024267
[exp]
3.5 0.9228
AT2G33040 ATP3 gamma subunit of Mt ATP syntha... Lus10007534
[exp]
4.2 0.9293
AT4G30010 unknown protein Lus10015329
[exp]
4.9 0.9115
AT4G27070 TSB2 tryptophan synthase beta-subun... Lus10043059
[exp]
6.0 0.9340
AT4G24330 Protein of unknown function (D... Lus10015491
[exp]
7.3 0.9164
AT4G37830 cytochrome c oxidase-related (... Lus10019250
[exp]
7.5 0.9369

Lus10012024 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.