Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G01710 92 / 1e-23 ARPC5, CRK CROOKED, ARP2/3 complex 16 kDa subunit (p16-Arc) (.1) AT5G65274 91 / 6e-23 ARP2/3 complex 16 kDa subunit (p16-Arc) (.1) AT3G18990 64 / 8e-12 B3 REM39, VRN1 REDUCED VERNALIZATION RESPONSE 1, REPRODUCTIVE MERISTEM 39, AP2/B3-like transcriptional factor family protein (.1) AT3G18960 55 / 4e-09 B3 AP2/B3-like transcriptional factor family protein (.1) AT1G49475 53 / 2e-08 B3 AP2/B3-like transcriptional factor family protein (.1) AT4G01580 50 / 1e-07 B3 AP2/B3-like transcriptional factor family protein (.1) AT4G33280 49 / 9e-07 B3 REM16 AP2/B3-like transcriptional factor family protein (.1) AT2G16210 40 / 0.0005 B3 Transcriptional factor B3 family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012046 [exp] 231 / 3e-74 AT3G18960 82 / 7e-18 AP2/B3-like transcriptional factor family protein (.1) Lus10027943 [exp] 224 / 1e-71 AT3G18960 76 / 9e-16 AP2/B3-like transcriptional factor family protein (.1) Lus10012038 [exp] 221 / 3e-71 AT3G18990 67 / 5e-12 REDUCED VERNALIZATION RESPONSE 1, REPRODUCTIVE MERISTEM 39, AP2/B3-like transcriptional factor family protein (.1) Lus10027941 [exp] 112 / 4e-32 AT4G01710 89 / 1e-24 CROOKED, ARP2/3 complex 16 kDa subunit (p16-Arc) (.1) Lus10028192 [exp] 113 / 7e-32 AT4G01710 236 / 5e-82 CROOKED, ARP2/3 complex 16 kDa subunit (p16-Arc) (.1) Lus10042895 [exp] 114 / 3e-31 AT4G01710 224 / 9e-76 CROOKED, ARP2/3 complex 16 kDa subunit (p16-Arc) (.1) Lus10035637 [exp] 89 / 5e-20 AT3G18990 91 / 9e-20 REDUCED VERNALIZATION RESPONSE 1, REPRODUCTIVE MERISTEM 39, AP2/B3-like transcriptional factor family protein (.1) Lus10010759 [exp] 87 / 7e-20 AT3G18990 91 / 1e-20 REDUCED VERNALIZATION RESPONSE 1, REPRODUCTIVE MERISTEM 39, AP2/B3-like transcriptional factor family protein (.1) Lus10010756 [exp] 78 / 6e-17 AT3G18990 99 / 2e-23 REDUCED VERNALIZATION RESPONSE 1, REPRODUCTIVE MERISTEM 39, AP2/B3-like transcriptional factor family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G136500 [exp] 89 / 1e-22 AT4G01710 224 / 4e-77 CROOKED, ARP2/3 complex 16 kDa subunit (p16-Arc) (.1) Potri.014G045200 [exp] 75 / 5e-17 AT4G01710 208 / 9e-71 CROOKED, ARP2/3 complex 16 kDa subunit (p16-Arc) (.1) Potri.010G191500 [exp] 76 / 1e-15 AT3G18990 189 / 5e-57 REDUCED VERNALIZATION RESPONSE 1, REPRODUCTIVE MERISTEM 39, AP2/B3-like transcriptional factor family protein (.1) Potri.004G147200 [exp] 60 / 2e-10 AT1G49480 110 / 5e-28 related to vernalization1 1 (.1) Potri.004G147000 [exp] 60 / 2e-10 AT3G18990 258 / 3e-83 REDUCED VERNALIZATION RESPONSE 1, REPRODUCTIVE MERISTEM 39, AP2/B3-like transcriptional factor family protein (.1) Potri.014G036900 [exp] 57 / 1e-09 AT4G33280 256 / 5e-83 AP2/B3-like transcriptional factor family protein (.1) Potri.009G108500 [exp] 57 / 2e-09 AT3G18990 395 / 2e-137 REDUCED VERNALIZATION RESPONSE 1, REPRODUCTIVE MERISTEM 39, AP2/B3-like transcriptional factor family protein (.1) Potri.004G146900 [exp] 55 / 1e-08 AT3G18990 353 / 6e-121 REDUCED VERNALIZATION RESPONSE 1, REPRODUCTIVE MERISTEM 39, AP2/B3-like transcriptional factor family protein (.1) Potri.002G129800 [exp] 52 / 1e-07 AT4G33280 159 / 9e-45 AP2/B3-like transcriptional factor family protein (.1) Potri.014G057101 [exp] 46 / 6e-06 AT3G18990 76 / 5e-16 REDUCED VERNALIZATION RESPONSE 1, REPRODUCTIVE MERISTEM 39, AP2/B3-like transcriptional factor family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0405 [flax] [poplar] DNA_b-psBarrel PF02362 [flax] [poplar] B3 B3 DNA binding domain
Representative CDS sequence Show only first row Show all	>Lus10012040 pacid=23161494 polypeptide=Lus10012040 locus=Lus10012040.g ID=Lus10012040.BGIv1.0 annot-version=v1.0 ATGGCCGGTGCTGACGGATTTGTGGAAGCAGAGAACGCCGAGGCAATCATTACCAGAATCGAACACAAGTCTCGCAAGATCGAGAGCTTACTCAAACAGT ACAAGCCAGTGGAAGCGCTCAAGACAGCGCTTGAAGGATCGCCTCCCAAGACTGGCGATGAGCGATGCAAGCCGCTGCCGATCAAGTTCGCGACAAAGCA CGGAAGGAAGCTGGCGATGAAGGAGTGGTCAAATGCAAAGCTCTGCCTGCCGAACGGCACGGTATTCGAAGCCGGCATAACCGCAGGAAAAGACCACAAT GACCTCTGGTTCAAAACAGGGTGGTCCAAGTTCATGGATGACAACTCCATCAAGGAGAAGTTCGTCCTCGCTTTCGAGTACGTCGGCGAATCGAGGTTCA ACATCCGGATATTCGATCTGTCCATGTCCAAGATCCTCTACACACCACAACCGCCGGCCGTCGTCGCCGGCGAATGCGAGGCTTTGCTGGATGAACTGGC GGCAAGAGGAATCCATGTGGCCAATAAATTCAGCTGTATGACATTCCCAATAATATCTTCGGAAAGCAAGAGGGCTATGCAAGAAGCGATGAAGAACAAG CGGGAAGACGACGCGGTTCCTTCTTTCATCGTCGTGATGAATCCGTGCGGGGGAAAAAACTCAAAAAGACCTACCGCATTGTAA
AA sequence Show only first row Show all	>Lus10012040 pacid=23161494 polypeptide=Lus10012040 locus=Lus10012040.g ID=Lus10012040.BGIv1.0 annot-version=v1.0 MAGADGFVEAENAEAIITRIEHKSRKIESLLKQYKPVEALKTALEGSPPKTGDERCKPLPIKFATKHGRKLAMKEWSNAKLCLPNGTVFEAGITAGKDHN DLWFKTGWSKFMDDNSIKEKFVLAFEYVGESRFNIRIFDLSMSKILYTPQPPAVVAGECEALLDELAARGIHVANKFSCMTFPIISSESKRAMQEAMKNK REDDAVPSFIVVMNPCGGKNSKRPTAL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G01710		ARPC5, CRK	CROOKED, ARP2/3 complex 16 kDa...		Lus10012040 [exp]	0	1
AT5G12040			Nitrilase/cyanide hydratase an...		Lus10025012 [exp]	3.2	0.9087
					Lus10033298 [exp]	4.6	0.8822
AT3G52120			SWAP (Suppressor-of-White-APri...		Lus10037485 [exp]	7.3	0.8849
AT5G44090			Calcium-binding EF-hand family...		Lus10003628 [exp]	7.9	0.8917
AT4G35785			RNA-binding (RRM/RBD/RNP motif...		Lus10041854 [exp]	11.4	0.8772
AT4G17380		MSH4, ATMSH4	ARABIDOPSIS MUTS HOMOLOG 4, M...		Lus10000166 [exp]	11.8	0.8632
AT2G19260			RING/FYVE/PHD zinc finger supe...		Lus10020162 [exp]	12.2	0.8858
AT1G53025			Ubiquitin-conjugating enzyme f...		Lus10042852 [exp]	12.2	0.8745
AT5G55100			SWAP (Suppressor-of-White-APri...		Lus10032646 [exp]	13.3	0.8987
AT3G18215			Protein of unknown function, D...		Lus10009640 [exp]	13.4	0.8788

Compare expression of checked genes

Lus10012040 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.