Lus10012049 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G03560 239 / 7e-80 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027932 251 / 2e-85 AT5G03560 188 / 5e-61 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G096900 258 / 2e-87 AT5G03560 268 / 3e-91 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF09350 DUF1992 Domain of unknown function (DUF1992)
Representative CDS sequence
>Lus10012049 pacid=23161500 polypeptide=Lus10012049 locus=Lus10012049.g ID=Lus10012049.BGIv1.0 annot-version=v1.0
ATGGCCGGAATCCGACGCCTCCGTGGCCTCTTCTCCTCCGTAATCAGCCCGCTTCCCAAACCAACGGCGGAGGATTCCTCGTTCCTAACTAGGCGGTTCG
CATCGTCTTATTCTCCTTCCTCGTCGAAGCCTCGGAAGAAGGCGGACCGTCTGTCGACAGTGATCGACGCAGTCAACGACCGGAAGCTCCCTCCTGAACT
CCGCGGCCAGCGCAACTCCGTGAGGTCAGAAACGGACATTATCAACGTGGTTGAGCAACGAATATGGCATTCAATGGAAGAAGGGCAATTCGAGAACTTG
CCGGGGAAAGGGAAACCTCTCAACCTCGACACCAATCCGCACGCTGACCCGGCCGAAGACACGCTGTACAGGATCCTCTCCAAGAACAACTGCGCCCCGG
AGTGGGTTGAGCTGAACAAGGAGATCAGGAGCCAGATTTTGGAGTGGCGGTCCGGGTTGAAGAAAGCATTCGCGGCTAACAAATGCAACCGTGATGAAGT
GTCTGAAGCCCTGAAAGCTCAGTTGAAAAGCATCAATAACAAGGTCAGCCCCTGTTCATCAACACTCACGACCGATTCCTCTATGCAGAAGATGATCGTT
GTGGATGTGTACGCGTTTTGTTCGCAGGTTTTCAAGTATAACCTCATCGTACCATTTGGTCGGCAGATGATTGGATTCAAGTGGGAGAAGGAGCTGGATC
GCTTGAATGAACAACATTAA
AA sequence
>Lus10012049 pacid=23161500 polypeptide=Lus10012049 locus=Lus10012049.g ID=Lus10012049.BGIv1.0 annot-version=v1.0
MAGIRRLRGLFSSVISPLPKPTAEDSSFLTRRFASSYSPSSSKPRKKADRLSTVIDAVNDRKLPPELRGQRNSVRSETDIINVVEQRIWHSMEEGQFENL
PGKGKPLNLDTNPHADPAEDTLYRILSKNNCAPEWVELNKEIRSQILEWRSGLKKAFAANKCNRDEVSEALKAQLKSINNKVSPCSSTLTTDSSMQKMIV
VDVYAFCSQVFKYNLIVPFGRQMIGFKWEKELDRLNEQH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G03560 Tetratricopeptide repeat (TPR)... Lus10012049 0 1
AT5G49320 Protein of unknown function (D... Lus10037723 1.4 0.9157
AT3G63520 ATNCED1, ATCCD1... carotenoid cleavage dioxygenas... Lus10029513 2.4 0.9208
AT1G27480 alpha/beta-Hydrolases superfam... Lus10018664 6.1 0.8543
AT5G08410 FTRA2 ferredoxin/thioredoxin reducta... Lus10041002 7.3 0.9085
AT4G16380 Heavy metal transport/detoxifi... Lus10000039 9.9 0.8930
AT1G06040 CO BBX24, STO SALT TOLERANCE, B-box domain p... Lus10025579 10.2 0.9062
AT1G06040 CO BBX24, STO SALT TOLERANCE, B-box domain p... Lus10027041 10.2 0.8961
AT1G03495 HXXXD-type acyl-transferase fa... Lus10033754 10.8 0.8817
AT1G53670 MSRB1, ATMSRB1 methionine sulfoxide reductase... Lus10013727 12.0 0.9011
AT3G11420 Protein of unknown function (D... Lus10002713 14.5 0.8970

Lus10012049 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.