Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G77940 145 / 2e-46 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) AT3G18740 144 / 1e-45 RLK902 receptor-like kinase 902, Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) AT1G36240 144 / 1e-45 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027926 [exp] 171 / 6e-57 AT1G77940 160 / 1e-52 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) Lus10016432 [exp] 157 / 6e-51 AT1G36240 202 / 4e-69 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) Lus10016431 [exp] 157 / 6e-51 AT1G36240 202 / 4e-69 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) Lus10019682 [exp] 156 / 1e-50 AT1G36240 199 / 1e-67 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) Lus10019681 [exp] 154 / 8e-50 AT1G36240 201 / 2e-68 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G196500 [exp] 157 / 4e-51 AT1G36240 208 / 2e-71 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) Potri.009G158700 [exp] 157 / 4e-51 AT1G36240 208 / 2e-71 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) Potri.007G086800 [exp] 154 / 5e-50 AT1G77940 207 / 6e-71 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) Potri.005G080700 [exp] 152 / 3e-49 AT1G77940 208 / 2e-71 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0101 [flax] [poplar] PELOTA PF01248 [flax] [poplar] Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Representative CDS sequence Show only first row Show all	>Lus10012057 pacid=23161439 polypeptide=Lus10012057 locus=Lus10012057.g ID=Lus10012057.BGIv1.0 annot-version=v1.0 ATGAAGAGTGGCAAGTACTCTCTCGGCTACAAGACCGTTCTCAAGACCTTGAGGAACTCCAAAGGTAAGTTGGTGATCATTGCCAACAACTGCCCACCTC TTAGGAAGTCTGAGATTGAGTACTATGCTATGTTGTCCAAGGTTGGAGTTCATCACTACAGTGGCAATTGTTCCTTTATCTCTGCCAATGCTGAACGGAC CAGCTTCCATTTTCTGATGCTCTTTAACCTACGGATTGCTCACATGGATTGTGTACTTGTTGCAGACAATGTAGAATTGGGAACAGCCTGTGGTAAATAC TTCAGAGTCTGCTGCCTCAGCATTATTGATGCAGGTGATTCTGATATCATTAAGAACATGCCAAGCGATCACTAA
AA sequence Show only first row Show all	>Lus10012057 pacid=23161439 polypeptide=Lus10012057 locus=Lus10012057.g ID=Lus10012057.BGIv1.0 annot-version=v1.0 MKSGKYSLGYKTVLKTLRNSKGKLVIIANNCPPLRKSEIEYYAMLSKVGVHHYSGNCSFISANAERTSFHFLMLFNLRIAHMDCVLVADNVELGTACGKY FRVCCLSIIDAGDSDIIKNMPSDH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G77940			Ribosomal protein L7Ae/L30e/S1...		Lus10012057 [exp]	0	1
AT5G27700			Ribosomal protein S21e (.1)		Lus10029895 [exp]	3.7	0.9436
AT3G61110		ARS27A	ribosomal protein S27 (.1)		Lus10024576 [exp]	4.0	0.9414
AT3G62870			Ribosomal protein L7Ae/L30e/S1...		Lus10015841 [exp]	6.3	0.9477
AT1G04480			Ribosomal protein L14p/L23e fa...		Lus10022881 [exp]	8.1	0.9219
AT1G09590			Translation protein SH3-like f...		Lus10030607 [exp]	10.1	0.9416
AT1G63270		ABCI1, ATNAP10	ATP-binding cassette I1, non-i...		Lus10022692 [exp]	11.0	0.9064
AT5G25500			unknown protein		Lus10002897 [exp]	14.5	0.9084
AT4G15770			RNA binding (.1)		Lus10037509 [exp]	14.9	0.9188
AT4G13850		ATGRP2, GR-RBP2	glycine rich protein 2, glycin...		Lus10032591 [exp]	16.3	0.9306
AT2G42740		RPL16A	ribosomal protein large subuni...		Lus10020715 [exp]	18.3	0.9364

Compare expression of checked genes

Lus10012057 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.