Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10012065 pacid=23161456 polypeptide=Lus10012065 locus=Lus10012065.g ID=Lus10012065.BGIv1.0 annot-version=v1.0 ATGGCTGACAGAGGAAGAAAAGGATCAACGTTTGATGGTTTGATCATCATCAGCTTCATCGCGTTGACAATCTTCGTATCTTCTCACACTTTGATGGCTG ATCATCACCGTCGGCTTCTCCTGAAACTAGATGAGAAGGTTGTTGAGATTAAACGTGGTGAACAGAAGCACGGAGAAATTAAGATGGTGAAACAAGTGAT GAAGATTGGTGCACGATCAAGTGTGTCGGAGAAAGCCAGGCATCCTGGCCATGGCCACGGTCCGCCAAATTAA
AA sequence Show only first row Show all	>Lus10012065 pacid=23161456 polypeptide=Lus10012065 locus=Lus10012065.g ID=Lus10012065.BGIv1.0 annot-version=v1.0 MADRGRKGSTFDGLIIISFIALTIFVSSHTLMADHHRRLLLKLDEKVVEIKRGEQKHGEIKMVKQVMKIGARSSVSEKARHPGHGHGPPN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10012065 [exp]	0	1
AT4G27290			S-locus lectin protein kinase ...		Lus10038553 [exp]	2.0	0.9459
AT3G43740			Leucine-rich repeat (LRR) fami...		Lus10002117 [exp]	13.6	0.8948
AT4G12300		CYP706A4	"cytochrome P450, family 706, ...		Lus10032026 [exp]	14.2	0.8967
AT4G27290			S-locus lectin protein kinase ...		Lus10014811 [exp]	16.4	0.8981
AT5G40780		LHT1, LTH1	lysine histidine transporter 1...		Lus10022329 [exp]	24.5	0.8903
					Lus10012066 [exp]	26.0	0.8697
AT5G05340			Peroxidase superfamily protein...		Lus10025255 [exp]	26.5	0.8860
AT1G32100		ATPRR1	pinoresinol reductase 1 (.1)		Lus10012145 [exp]	27.0	0.8376
AT5G65030			unknown protein		Lus10014339 [exp]	29.4	0.8907
AT5G10530			Concanavalin A-like lectin pro...		Lus10014652 [exp]	29.5	0.8895

Compare expression of checked genes

Lus10012065 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.