Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10012066 pacid=23161491 polypeptide=Lus10012066 locus=Lus10012066.g ID=Lus10012066.BGIv1.0 annot-version=v1.0 ATGGTAGATATTAGAAGCAGTGGAGGAAAGGTTCTGGTTTCCATGGCCATAAGCTTGGTCCTCGTAGTTGCCTTCTCGTCGGAGACTTCGATGGCTGATC GTGTCGTACATCTCTCGAAACTCGAGAAATTCGGTGAACAGCGAAAGACAAAAAATCTTAAAGAACTCCGAGAGTCGAAACTTGTTGTAAGTGGAAGTGA TTCACACGTAAGCCACCATGGGAATCATAGGCGTGGTAATGACGGTGGTCGTCGATTACTTCAATTCACCACTTCTACTATGATGTAA
AA sequence Show only first row Show all	>Lus10012066 pacid=23161491 polypeptide=Lus10012066 locus=Lus10012066.g ID=Lus10012066.BGIv1.0 annot-version=v1.0 MVDIRSSGGKVLVSMAISLVLVVAFSSETSMADRVVHLSKLEKFGEQRKTKNLKELRESKLVVSGSDSHVSHHGNHRRGNDGGRRLLQFTTSTMM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10012066 [exp]	0	1
AT4G23180		RLK4, CRK10	cysteine-rich RLK (RECEPTOR-li...		Lus10007631 [exp]	6.6	0.9106
					Lus10016424 [exp]	8.1	0.8867
AT4G10300			RmlC-like cupins superfamily p...		Lus10037245 [exp]	10.7	0.8958
					Lus10028488 [exp]	13.9	0.8867
AT4G27290			S-locus lectin protein kinase ...		Lus10014810 [exp]	14.1	0.9071
AT1G21000			PLATZ transcription factor fam...		Lus10023411 [exp]	16.1	0.8871
AT3G21630		LYSMRLK1, CERK1	LYSM DOMAIN RECEPTOR-LIKE KINA...		Lus10035301 [exp]	16.4	0.9049
AT2G02800		Kin2, APK2B	protein kinase 2B (.1.2)		Lus10022591 [exp]	16.4	0.9085
AT3G12910	NAC		NAC (No Apical Meristem) domai...		Lus10031766 [exp]	22.4	0.8479
AT2G03590		ATUPS1	ureide permease 1 (.1)		Lus10036910 [exp]	25.7	0.8763

Compare expression of checked genes

Lus10012066 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.