Lus10012067 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027915 100 / 4e-28 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10012067 pacid=23161421 polypeptide=Lus10012067 locus=Lus10012067.g ID=Lus10012067.BGIv1.0 annot-version=v1.0
ATGGTGGGTCGTCGATGTGTTACGATGATGATAAGTCTGGTTCTGTTTGTAGCCTTATCGTCTCAGATTGTAATGTCGTCTCATCAACAGGCTACGCATT
ATTTTCAGAATCCTGATGATCAGAAGACTGTAGAAGAAATTTATGAAAAGAAGCGTGAAGAAGAGTTGAAACAAATGAAGATTACTGCACGGCCAAGTAT
ATCAAGTCCAGCTCGTCATGCCTCCCCTCCTCCTCCTCGTCCTCTTGGTCCTCCGCCTCCTTCTCCGCCGCTGCCGCCACCGCCAGCTGGTCGTTTCTAT
CCGCCTTCACCTCCGCCGTGTACTTTTCATCCGCCTCCACCTCCCAAGTCGTCACACAAATTCTAG
AA sequence
>Lus10012067 pacid=23161421 polypeptide=Lus10012067 locus=Lus10012067.g ID=Lus10012067.BGIv1.0 annot-version=v1.0
MVGRRCVTMMISLVLFVALSSQIVMSSHQQATHYFQNPDDQKTVEEIYEKKREEELKQMKITARPSISSPARHASPPPPRPLGPPPPSPPLPPPPAGRFY
PPSPPPCTFHPPPPPKSSHKF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10012067 0 1
AT5G23160 unknown protein Lus10010194 2.4 0.9514
AT3G46510 ATPUB13 ARABIDOPSIS THALIANA PLANT U-B... Lus10017444 3.2 0.9314
AT3G07840 Pectin lyase-like superfamily ... Lus10003001 6.0 0.8977
AT5G66170 STR18 sulfurtransferase 18 (.1.2.3) Lus10041894 8.4 0.9063
AT1G05260 RCI3A, RCI3 RARE COLD INDUCIBLE GENE 3, Pe... Lus10032926 9.0 0.9227
AT1G71910 unknown protein Lus10016934 11.0 0.8976
AT4G38260 Protein of unknown function (D... Lus10016024 11.5 0.9115
Lus10041112 17.3 0.9006
AT1G15520 ATABCG40, ABCG4... Arabidopsis thaliana ATP-bindi... Lus10008090 22.2 0.9027
AT5G18150 Methyltransferase-related prot... Lus10005698 24.4 0.9096

Lus10012067 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.