Lus10012084 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010259 125 / 1e-36 ND /
Lus10002894 127 / 2e-35 AT1G06620 369 / 2e-125 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10020965 119 / 2e-34 ND /
Lus10034011 116 / 9e-34 ND /
Lus10005115 96 / 9e-27 ND /
Lus10010258 59 / 2e-12 ND /
Lus10034328 57 / 1e-10 ND /
Lus10010248 56 / 1e-10 ND /
Lus10001094 53 / 6e-10 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10012084 pacid=23146015 polypeptide=Lus10012084 locus=Lus10012084.g ID=Lus10012084.BGIv1.0 annot-version=v1.0
ATGGCAAATGTGATAGATGGTTCTGTTGGTGGCGAGGACGGTGATGAAAATCATCGTCCTAAGAAGGTGAAGAAAGAATGGTATAATCTACATATGGTCG
GTAAGTCTTTGTTTGCATTTCAGGTGTATAAAGGAGGATCTTCTTCTGTTGGTTCCCAACAAACAGCGAATCAGAATATTCCCGAGTACTTTACCACCTT
TCAATCTCAAATCTTAGGCCTTCTTACTAACTCGGGGATTGGCTTGACTCTGGAATTGGAGGCGGTGAAGAATCTATTCGAAAGTCAAGGGGAGGCTGGT
AAAAAAATACTCGAGGCTCAAGGATGTGGTAGTAGCACAGCGCCACCGGATACCAACACTCCAACGGACATGGATGAAGATCAAAGGGACAATGAAGACC
AGACGGGAAATCAAGATGATGAAAATGACGATAAAGAGTAG
AA sequence
>Lus10012084 pacid=23146015 polypeptide=Lus10012084 locus=Lus10012084.g ID=Lus10012084.BGIv1.0 annot-version=v1.0
MANVIDGSVGGEDGDENHRPKKVKKEWYNLHMVGKSLFAFQVYKGGSSSVGSQQTANQNIPEYFTTFQSQILGLLTNSGIGLTLELEAVKNLFESQGEAG
KKILEAQGCGSSTAPPDTNTPTDMDEDQRDNEDQTGNQDDENDDKE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10012084 0 1
AT2G45550 CYP76C4 "cytochrome P450, family 76, s... Lus10028896 1.7 0.8587
AT5G42250 Zinc-binding alcohol dehydroge... Lus10021239 5.8 0.8544
AT4G02270 RHS13 root hair specific 13 (.1) Lus10013419 9.3 0.8389
AT1G20330 FRL1, CVP1, SMT... FRILL1, COTYLEDON VASCULAR PAT... Lus10004158 10.0 0.7915
AT5G44400 FAD-binding Berberine family p... Lus10027162 11.2 0.7915
AT3G23350 ENTH/VHS family protein (.1) Lus10021173 12.2 0.7915
Lus10000984 13.2 0.7915
Lus10012326 13.6 0.6284
Lus10040014 14.1 0.7915
AT3G05550 Hypoxia-responsive family prot... Lus10031490 15.0 0.7915

Lus10012084 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.