Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G30380 144 / 2e-45 PSAK photosystem I subunit K (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007399 [exp] 210 / 2e-71 AT1G30380 174 / 1e-57 photosystem I subunit K (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G254200 [exp] 147 / 1e-46 AT1G30380 176 / 3e-58 photosystem I subunit K (.1) Potri.018G027600 [exp] 140 / 5e-44 AT1G30380 171 / 4e-56 photosystem I subunit K (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01241 [flax] [poplar] PSI_PSAK Photosystem I psaG / psaK
Representative CDS sequence Show only first row Show all	>Lus10012086 pacid=23146016 polypeptide=Lus10012086 locus=Lus10012086.g ID=Lus10012086.BGIv1.0 annot-version=v1.0 ATGGCAGCTTCCTCTATGGTGACTTGTCCAACTGCTACCTTCAACCGGCTAAGATCCCAAATCTCCGCTGGTCCTATCAGAACCAACTCTCTGGCGATGA GCAGCAGCAAGAGAGGAAGGTTGAATGTTAGAATGGACTTCATTGGGTCTCCGACAAACTTGATAATGGTGACATCGACAAGCTTGATGCTTTTCGCAGG GAGATTCGGACTGGCTCCATCCGCAAACAGGAAGGCTACTGCTGGATTGAAGCTGGAAGTGAGGGATTCTGGACTCCAAACAGGGGACCCAGCTGGCTTC ACTCTCGCTGATACCTTGGCTTGTGGTACTGTTGGCCACATCATTGGTGTTGGTGTTGTTCTTGGTCTAAAAAACATCGGTGCTCTCTAA
AA sequence Show only first row Show all	>Lus10012086 pacid=23146016 polypeptide=Lus10012086 locus=Lus10012086.g ID=Lus10012086.BGIv1.0 annot-version=v1.0 MAASSMVTCPTATFNRLRSQISAGPIRTNSLAMSSSKRGRLNVRMDFIGSPTNLIMVTSTSLMLFAGRFGLAPSANRKATAGLKLEVRDSGLQTGDPAGF TLADTLACGTVGHIIGVGVVLGLKNIGAL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G30380		PSAK	photosystem I subunit K (.1)		Lus10012086 [exp]	0	1
AT1G30380		PSAK	photosystem I subunit K (.1)		Lus10007399 [exp]	1.0	0.9945
AT1G52230		PSAH2, PSAH-2, ...	PHOTOSYSTEM I SUBUNIT H-2, pho...		Lus10025798 [exp]	1.4	0.9937
AT1G18170			FKBP-like peptidyl-prolyl cis-...		Lus10038954 [exp]	2.2	0.9868
AT2G20260		PSAE-2	photosystem I subunit E-2 (.1)		Lus10011913 [exp]	2.4	0.9909
AT1G72640			NAD(P)-binding Rossmann-fold s...		Lus10016517 [exp]	3.7	0.9669
AT3G27160		GHS1	GLUCOSE HYPERSENSITIVE 1, Ribo...		Lus10012528 [exp]	4.0	0.9613
AT4G12800		PSAL	photosystem I subunit l (.1)		Lus10002143 [exp]	4.2	0.9844
AT5G64040		PSAN, PSI-N	photosystem I reaction center ...		Lus10002084 [exp]	4.5	0.9881
AT4G05180		PSII-Q, PSBQ, P...	photosystem II subunit Q-2 (.1...		Lus10018385 [exp]	4.6	0.9816
AT1G67700			unknown protein		Lus10011383 [exp]	5.7	0.9719

Compare expression of checked genes

Lus10012086 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.