Lus10012107 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10012107 pacid=23154971 polypeptide=Lus10012107 locus=Lus10012107.g ID=Lus10012107.BGIv1.0 annot-version=v1.0
ATGCTGTTCTCTTGTCTCGCAATGCATCATAATCGATATGCTGGAAACCAGCAGATCTGGGAATTTCCTGCTGCTAGATATGGACTGTGGTGCTCGTTCA
AGGTGAGGTTTCTTCCATTCTCTTATGCTTATCCGACTATGCAGCCTAATCAAGAGGCTGGAAACCAGCAATGCTGCCACATGTGGGGTATTGCTCTTTG
A
AA sequence
>Lus10012107 pacid=23154971 polypeptide=Lus10012107 locus=Lus10012107.g ID=Lus10012107.BGIv1.0 annot-version=v1.0
MLFSCLAMHHNRYAGNQQIWEFPAARYGLWCSFKVRFLPFSYAYPTMQPNQEAGNQQCCHMWGIAL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10012107 0 1
AT1G17400 unknown protein Lus10039921 12.0 0.7948
AT1G66140 C2H2ZnF ZFP4 zinc finger protein 4 (.1) Lus10035169 18.8 0.7895
AT5G06500 MADS AGL96 AGAMOUS-like 96 (.1) Lus10012154 20.6 0.7818
AT2G37360 ABCG2 ATP-binding cassette G2, ABC-2... Lus10018624 27.3 0.7772
AT4G34770 SAUR-like auxin-responsive pro... Lus10007564 32.2 0.7771
AT2G38560 RDO2, TFIIS REDUCED DORMANCY 2, transcript... Lus10029016 33.8 0.7750
AT3G19184 B3 AP2/B3-like transcriptional fa... Lus10019872 35.7 0.7744
AT2G40390 unknown protein Lus10009844 36.7 0.7693
AT3G20820 Leucine-rich repeat (LRR) fami... Lus10033932 41.7 0.7659
Lus10041024 42.0 0.7692

Lus10012107 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.