Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G13810 114 / 1e-31 Restriction endonuclease, type II-like superfamily protein (.1) AT1G67660 94 / 4e-24 Restriction endonuclease, type II-like superfamily protein (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010434 [exp] 260 / 2e-88 AT1G13810 216 / 5e-68 Restriction endonuclease, type II-like superfamily protein (.1) Lus10017632 [exp] 205 / 2e-67 AT1G13810 216 / 6e-69 Restriction endonuclease, type II-like superfamily protein (.1) Lus10033589 [exp] 132 / 3e-37 AT1G13810 161 / 4e-45 Restriction endonuclease, type II-like superfamily protein (.1) Lus10011377 [exp] 89 / 6e-24 AT1G67660 169 / 1e-53 Restriction endonuclease, type II-like superfamily protein (.1.2.3) Lus10006437 [exp] 86 / 9e-23 AT1G67660 172 / 8e-55 Restriction endonuclease, type II-like superfamily protein (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G222500 [exp] 168 / 2e-52 AT1G13810 242 / 1e-78 Restriction endonuclease, type II-like superfamily protein (.1) Potri.010G054800 [exp] 100 / 9e-26 AT1G67660 391 / 7e-136 Restriction endonuclease, type II-like superfamily protein (.1.2.3) Potri.008G039800 [exp] 86 / 6e-22 AT1G13810 143 / 2e-42 Restriction endonuclease, type II-like superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10012108 pacid=23154953 polypeptide=Lus10012108 locus=Lus10012108.g ID=Lus10012108.BGIv1.0 annot-version=v1.0 ATGAGATTGGCGAGGCCTTGGAAACGAGTCCCTCTTTACTACATCCCGCAGGCTCAGGGTTTAATGGAGATTATGGACAGGGATTGGATGGACTTTTACG TTTGGACCCCAGGAGGGAGTAGCTTGTTCAGGATTCACAGAGACAGGGAGTACTGGGAAGTGATGAAGTTGGCTCTTGATGATTTTTGGTTGAAGCATGT CTGGCCCGCTAAGAAACTATGCGAGAAGTACCAGCTTAAGAACCCTTTTATGGAGCTTCCTTTGCTCAGGCCCGCTCCTAGACATCAGTACTGTGAATAT ATCATCCACGAGAGCAGACGGATCGTTGATGCCTCCCCGTTGTTGCTTTCTGAAATGGGTGGAATCGTAATCAGTCCACCCTATGAATGA
AA sequence Show only first row Show all	>Lus10012108 pacid=23154953 polypeptide=Lus10012108 locus=Lus10012108.g ID=Lus10012108.BGIv1.0 annot-version=v1.0 MRLARPWKRVPLYYIPQAQGLMEIMDRDWMDFYVWTPGGSSLFRIHRDREYWEVMKLALDDFWLKHVWPAKKLCEKYQLKNPFMELPLLRPAPRHQYCEY IIHESRRIVDASPLLLSEMGGIVISPPYE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G13810			Restriction endonuclease, type...		Lus10012108 [exp]	0	1
AT5G46230			Protein of unknown function, D...		Lus10000355 [exp]	8.7	0.8597
AT1G61370			S-locus lectin protein kinase ...		Lus10034711 [exp]	9.7	0.7557
					Lus10037918 [exp]	10.5	0.7402
					Lus10011453 [exp]	11.2	0.8570
AT1G11340			S-locus lectin protein kinase ...		Lus10013247 [exp]	12.4	0.7772
AT2G03380			Pentatricopeptide repeat (PPR)...		Lus10026641 [exp]	15.1	0.8465
AT2G43040		NPG1	no pollen germination 1, tetra...		Lus10033595 [exp]	16.0	0.7680
AT2G13570	CCAAT	NF-YB7	"nuclear factor Y, subunit B7"...		Lus10033477 [exp]	17.6	0.8492
AT4G29250			HXXXD-type acyl-transferase fa...		Lus10041782 [exp]	18.8	0.8488
AT2G40390			unknown protein		Lus10009844 [exp]	22.1	0.8483

Compare expression of checked genes

Lus10012108 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.